2WWX: Ras-related protein rab-1

Crystal structure of the SidM/DrrA(GEF/GDF domain)-Rab1(GTPase domain) complex. Determined by X-ray diffraction at 1.5 Å resolution. Released 8 Dec 2009.

Method: X-ray diffraction
Resolution: 1.5 Å
Organisms: HOMO SAPIENS, LEGIONELLA PNEUMOPHILA
Chains: 2
Atoms: 3,038
Mol. weight: 44.17 kDa
Released: 8 Dec 2009

Explore 2WWX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WWX contains 18 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
α-helix	21-25	5
β-strand	29	1	1
α-helix	30-31	2
α-helix	36-41	6
β-strand	45-52	8	1
β-strand	55-62	8	1
α-helix	67-69	3
α-helix	75-77	3
β-strand	83-89	7	1
α-helix	93-109	17
β-strand	115-122	8	1
α-helix	133-143	11
β-strand	147-151	5	1
β-strand	154	1	1
α-helix	156-172	17

Chain B: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	336-361	26
α-helix	365-381	17
α-helix	386-389	4
α-helix	390-393	4
α-helix	400-419	20
α-helix	428-447	20
α-helix	452-454	3
α-helix	464-478	15
β-strand	484-485	2	2
β-strand	488-489	2	2
α-helix	490-506	17
α-helix	512-520	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein rab-1	A	protein	175	HOMO SAPIENS	P62820 (AlphaFold model)
Drra	B	protein	217	LEGIONELLA PNEUMOPHILA	Q5ZSQ3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WWX_1 RAS-RELATED PROTEIN RAB-1 (chains A)
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ
IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVG
IKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGP

Sequence of entity 2 (B), FASTA

>2WWX_2 DRRA (chains B)
MPYSDAKAMLDEVAKIRELGVQRVTRIENLENAKKLWDNANSMLEKGNISGYLKAANELH
KFMKEKNLKEDDLRPELSDKTISPKGYAILQSLWGAASDYSRAAATLTESTVEPGLVSAV
NKMSAFFMDCKLSPNERATPDPDFKVGKSKILVGIMQFIKDVADPTSKIWMHNTKALMNH
KIAAIQKLERSNNVNDETLESVLSSKGENLSEYLSYK

Primary citation

Structural Insights Into the Dual Nucleotide Exchange and Gdi Displacement Activity of Sidm/Drra. Suh, H.Y., Lee, D.W., Lee, K.H. et al. EMBO J (2010) 29:496. DOI 10.1038/EMBOJ.2009.347 · PubMed

Other PDB entries of the same protein (UniProt P62820 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EQ2 1.55 Å, Crystal structure of GDP-bound Rab1a-T75D
3SFV 1.73 Å, Crystal structure of the GDP-bound Rab1a S25N mutant in complex with the coiled-coil…
3TKL 2.18 Å, Crystal structure of the GTP-bound Rab1a in complex with the coiled-coil domain of LidA…
2FOL 2.63 Å, Crystal structure of human RAB1A in complex with GDP
9MHF 2.73 Å, Cryo-EM reconstruction of PI3KC3-C1 in complex with Human RAB1A(Q70L)
4JVS 2.78 Å, Crystal structure of LepB GAP domain from Legionella drancourtii in complex with…
4FMC 2.8 Å, EspG-Rab1 complex
3L0I 2.85 Å, Complex structure of SidM/DrrA with the wild type Rab1
4FMD 3.05 Å, EspG-Rab1 complex structure at 3.05 A
4FMB 3.2 Å, VirA-Rab1 complex structure
4IRU 3.2 Å, Crystal Structure of lepB GAP core in a transition state mimetic complex with Rab1A and…
9MHG 3.2 Å, Cryo EM reconstruction of PI3KC3-C1 in complex with Human RAB1A(Q70L), VPS34 kinase…

Browse structure collections

About this viewer

MolViewer shows 2WWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.