3L0I: DrrA

Complex structure of SidM/DrrA with the wild type Rab1. Determined by X-ray diffraction at 2.85 Å resolution. Released 22 Dec 2009.

Method: X-ray diffraction
Resolution: 2.85 Å
Organisms: Legionella pneumophila, Homo sapiens
Chains: 4
Atoms: 7,704
Mol. weight: 129.88 kDa
Released: 22 Dec 2009

Explore 3L0I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L0I contains 48 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	214-224	11
α-helix	229-231	3
β-strand	239	1	1
α-helix	240	1
α-helix	241-245	5
α-helix	246-258	13
α-helix	271-280	10
α-helix	286-307	22
β-strand	316	1	1
α-helix	320-322	3
α-helix	323-361	39
α-helix	365-381	17
α-helix	386-389	4
α-helix	391-393	3
α-helix	400-419	20
α-helix	428-447	20
α-helix	449	1
α-helix	464-478	15
β-strand	484-485	2	2
β-strand	488-489	2	2
α-helix	490-506	17
α-helix	512-519	8
α-helix	526-529	4

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	3
β-strand	32	1	3
α-helix	39-44	6
β-strand	48-55	8	3
β-strand	58-65	8	3
β-strand	86-89	4	3
α-helix	97-110	14
β-strand	118-121	4	3
α-helix	141-144	4
β-strand	150	1	3
α-helix	159-168	10

Chain C: 18 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	211-222	12
α-helix	223-227	5
α-helix	230-232	3
β-strand	237-239	3	4
α-helix	241-245	5
α-helix	246-259	14
α-helix	271-280	10
α-helix	286-309	24
β-strand	316-318	3	4
α-helix	319-361	43
α-helix	365-381	17
α-helix	386-389	4
α-helix	390-393	4
α-helix	400-419	20
α-helix	428-447	20
α-helix	452-454	3
α-helix	464-478	15
β-strand	484-485	2	5
β-strand	488-489	2	5
α-helix	490-506	17
α-helix	512-519	8
α-helix	526-529	4

Chain D: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	10-18	9	6
α-helix	24-28	5
β-strand	32	1	6
α-helix	39-44	6
β-strand	48-55	8	6
β-strand	58-65	8	6
α-helix	70-72	3
α-helix	78-81	4
β-strand	86-92	7	6
α-helix	96-112	17
β-strand	118-124	7	6
α-helix	136-145	10
β-strand	150-153	4	6
α-helix	159-174	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DrrA	A, C	protein	363	Legionella pneumophila	Q5ZSQ3 (AlphaFold model)
Ras-related protein Rab-1A	B, D	protein	199	Homo sapiens	P62820 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3L0I_1 DrrA (chains A, C)
GPLGSPRYELGEELRDKIKQEPSFSNMVSAKKFYNKAIKDFTAPKEGAEVVSVKTHIMRP
IDFMLMGLREEFNLYSEDGAHLSAPGTIRLLREKNLLPEEQIARIESVYNQAMSKRFELH
AEHKKEHDEMPYSDAKAMLDEVAKIRELGVQRVTRIENLENAKKLWDNANSMLEKGNISG
YLKAANELHKFMKEKNLKEDDLRPELSDKTISPKGYAILQSLWGAASDYSRAAATLTEST
VEPGLVSAVNKMSAFFMDCKLSPNERATPDPDFKVGKSKILVGIMQFIKDVADPTSKIWM
HNTKALMNHKIAAIQKLERSNNVNDETLESVLSSKGENLSEYLSYKYATKDEGREHRYTA
STE

Sequence of entity 2 (B, D), FASTA

>3L0I_2 Ras-related protein Rab-1A (chains B, D)
MGSSHHHHHHSSGENLYFQGRPMSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTE
SYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQES
FNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNA
TNVEQSFMTMAAEIKKRMG

Primary citation

Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA. Zhu, Y., Hu, L., Zhou, Y. et al. Proc Natl Acad Sci U S A (2010) 107:4699-4704. DOI 10.1073/pnas.0914231107 · PubMed

Other PDB entries of the same protein (UniProt Q5ZSQ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WWX 1.5 Å, Crystal structure of the SidM/DrrA(GEF/GDF domain)-Rab1(GTPase domain) complex
3JZ9 1.8 Å, Crystal structure of the GEF domain of DrrA/SidM from Legionella pneumophila
3JZA 1.8 Å, Crystal structure of human Rab1b in complex with the GEF domain of DrrA/SidM from…
4MXP 1.83 Å, Structural Basis for PI(4)P-Specific Membrane Recruitment of the Legionella pneumophila…
3N6O 2.5 Å, Crystal structure of the GEF and P4M domain of DrrA/SidM from Legionella pneumophila
3L0M 3.45 Å, Crystal structure of Rab1-activation domain and P4M domain of SidM/DrrA from legionella

Browse structure collections

About this viewer

MolViewer shows 3L0I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.