2X11: Complete EphA2 ectodomain

Crystal structure of the complete EphA2 ectodomain in complex with ephrin A5 receptor binding domain. Determined by X-ray diffraction at 4.83 Å resolution. Released 16 Mar 2010.

Method: X-ray diffraction
Resolution: 4.83 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,889
Mol. weight: 80.26 kDa
Released: 16 Mar 2010

Explore 2X11 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X11 contains 21 α-helices and 62 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 54 β-strands

Element	Residues	Length	Sheet
β-strand	28-33	6	1
α-helix	34-36	3
β-strand	44-46	3	2
β-strand	53-59	7	1
β-strand	62-70	9	1
β-strand	79-82	4	2
α-helix	83-85	3
β-strand	86-87	2	2
β-strand	94-102	9	1
β-strand	103	1	3
α-helix	105-107	3
β-strand	116	1	4
β-strand	119-126	8	2
α-helix	136-138	3
α-helix	139	1
β-strand	140-145	6	2
β-strand	151	1	3
α-helix	154-157	4
β-strand	164-170	7	1
β-strand	177-184	8	2
β-strand	187	1	4
β-strand	188-199	12	1
β-strand	200-201	2	5
α-helix	202-203	2
β-strand	204-206	3	6
β-strand	209-211	3	6
β-strand	214-215	2	5
α-helix	216-217	2
β-strand	224-227	4	7
β-strand	229-230	2	6
α-helix	231	1
β-strand	234-235	2	8
β-strand	244-247	4	7
β-strand	253	1	7
β-strand	257	1	7
β-strand	261-262	2	8
β-strand	266-269	4	9
β-strand	272-275	4	9
α-helix	276-277	2
β-strand	280-281	2	10
α-helix	290	1
β-strand	291-292	2	10
α-helix	293	1
β-strand	297-298	2	11
α-helix	300-301	2
α-helix	307	1
β-strand	308-309	2	11
α-helix	310	1
β-strand	314	1	12
α-helix	324-325	2
β-strand	326	1	12
β-strand	332	1	13
β-strand	335-338	4	14
β-strand	344-348	5	14
β-strand	351	1	13
β-strand	361-369	9	15
β-strand	376-378	3	15
α-helix	379-380	2
β-strand	384-385	2	14
β-strand	392	1	15
β-strand	396-400	5	14
β-strand	407-415	9	15
α-helix	419-421	3
β-strand	427-431	5	15
β-strand	441-446	6	16
β-strand	453-457	5	16
α-helix	460-463	4
β-strand	468-475	8	17
β-strand	482-487	6	17
β-strand	491-493	3	16
β-strand	502-510	9	17
β-strand	517-518	2	17
β-strand	522-525	4	17

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	35-39	5	18
α-helix	45-48	4
β-strand	53-56	4	19
β-strand	61-65	5	18
β-strand	81-86	6	19
α-helix	88-93	6
β-strand	100-106	7	19
β-strand	117-121	5	18
β-strand	138-146	9	19
β-strand	158-163	6	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ephrin type-a receptor 2	A	protein	545	Homo sapiens	P29317 (AlphaFold model)
Ephrin-A5	B	protein	177	Homo sapiens	P52803 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2X11_1 EPHRIN TYPE-A RECEPTOR 2 (chains A)
MGILPSPGMPALLSLVSLLSVLLMGCVAKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNI
MNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKET
FNLYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGF
YLAFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPP
GGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTL
PSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGRE
DIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGV
SGLVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGD
SNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNGTKH
HHHHH

Sequence of entity 2 (B), FASTA

>2X11_2 EPHRIN-A5 (chains B)
MGILPSPGMPALLSLVSLLSVLLMGCVAAVADRYAVYWNSSNPRFQRGDYHIDVCINDYL
DVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKF
QLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKGTKHHHHHH

Primary citation

An Extracellular Steric Seeding Mechanism for Eph-Ephrin Signalling Platform Assembly. Seiradake, E., Harlos, K., Sutton, G. et al. Nat Struct Mol Biol (2010) 17:398. DOI 10.1038/NSMB.1782 · PubMed

Other PDB entries of the same protein (UniProt P29317 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q7D 0.98 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with the NVP-BHG712…
6Q7B 1.01 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with the NVP-BHG712…
6FNG 1.04 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with an isomer of…
6Q7G 1.05 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with the NVP-BHG712…
6Q7C 1.05 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with the NVP-BHG712…
6Q7E 1.06 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with the NVP-BHG712…
5NKF 1.1 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with Compound 3b
5NKG 1.1 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with Compound 3d
8BOM 1.12 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with Compound 14
6HES 1.13 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with the NVP-BHG712…
6Q7F 1.2 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with the NVP-BHG712…
6HET 1.21 Å, Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with the NVP-BHG712…

Browse structure collections

About this viewer

MolViewer shows 2X11 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.