2X44: Strand-swapped dimeric form of CTLA-4

Structure of a strand-swapped dimeric form of CTLA-4. Determined by X-ray diffraction at 2.6 Å resolution. Released 7 Apr 2010.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 964
Mol. weight: 14.09 kDa
Released: 7 Apr 2010

Explore 2X44 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X44 contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	1
α-helix	12-14	3
β-strand	19-25	7	1
β-strand	33-42	10	2
β-strand	45-54	10	2
α-helix	59-60	2
α-helix	62	1
β-strand	68-72	5	1
β-strand	76-81	6	1
α-helix	86-88	3
β-strand	91-99	9	2
α-helix	101-103	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytotoxic T-lymphocyte protein 4	D	protein	131	HOMO SAPIENS	P16410 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>2X44_1 CYTOTOXIC T-LYMPHOCYTE PROTEIN 4 (chains D)
MKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNE
LTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDP
EPSPDSDLVPR

Primary citation

Domain Metastability: A Molecular Basis for Immunoglobulin Deposition? Sonnen, A.F., Yu, C., Evans, E.J. et al. J Mol Biol (2010) 399:207. DOI 10.1016/J.JMB.2010.04.011 · PubMed

Other PDB entries of the same protein (UniProt P16410 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CIO 1.1 Å, Molecular interactions of cytoplasmic region of CTLA-4 with SH2 domains of PI3-kinase
9DQ3 1.64 Å, Crystal structure of engineered Ipilimumab (mipi.4) Fab in complex with human CTLA-4
3OSK 1.8 Å, Crystal structure of human CTLA-4 apo homodimer
5GGV 2.0 Å, CTLA-4 in complex with tremelimumab Fab
3BX7 2.1 Å, Engineered Human Lipocalin 2 (LCN2) in Complex with the Extracellular Domain of Human…
7ELX 2.14 Å, The crystal structure of CTLA-4 and Fab
7DV4 2.38 Å, Crystal structure of anti-CTLA-4 VH domain in complex with human CTLA-4
7SU0 2.41 Å, Crystal structure of an acidic pH-selective Ipilimumab variant Ipi.105 in complex with…
7SU1 2.53 Å, Crystal structure of an acidic pH-selective Ipilimumab variant Ipi.106 in complex with…
6RP8 2.6 Å, Crystal Structure of Ipilimumab Fab complexed with CTLA-4 at 2.6A resolution
8GAB 2.72 Å, Crystal structure of CTLA-4 in complex with a high affinity CTLA-4 binder
1I8L 3.0 Å, Human B7-1/CTLA-4 co-stimulatory complex

Browse structure collections

About this viewer

MolViewer shows 2X44 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.