Crystal Structure of the Human p21-Activated Kinase 4 in Complex with PF-03758309. Determined by X-ray diffraction at 2.1 Å resolution. Released 19 May 2010.
Explore 2X4Z in 3D Show helices and sheets RCSB PDB PDBe
2X4Z contains 21 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 301-311 | 11 | |
| α-helix | 313 | 1 | |
| α-helix | 317-319 | 3 | |
| β-strand | 321-329 | 9 | 1 |
| β-strand | 333-340 | 8 | 1 |
| β-strand | 346-353 | 8 | 1 |
| α-helix | 360-370 | 11 | |
| β-strand | 375 | 1 | 2 |
| β-strand | 378 | 1 | 2 |
| β-strand | 381-387 | 7 | 1 |
| β-strand | 390-396 | 7 | 1 |
| β-strand | 401-402 | 2 | 2 |
| α-helix | 403-407 | 5 | |
| α-helix | 414-433 | 20 | |
| β-strand | 436-437 | 2 | 3 |
| α-helix | 443-445 | 3 | |
| β-strand | 446-448 | 3 | 2 |
| β-strand | 454-456 | 3 | 2 |
| β-strand | 463-464 | 2 | 3 |
| β-strand | 472 | 1 | 4 |
| α-helix | 479-481 | 3 | |
| α-helix | 484-487 | 4 | |
| β-strand | 492 | 1 | 4 |
| α-helix | 495-510 | 16 | |
| α-helix | 520-529 | 10 | |
| α-helix | 532-533 | 2 | |
| α-helix | 538-540 | 3 | |
| α-helix | 543-552 | 10 | |
| α-helix | 557-559 | 3 | |
| α-helix | 561-562 | 2 | |
| α-helix | 563-566 | 4 | |
| α-helix | 570-574 | 5 | |
| α-helix | 578-581 | 4 | |
| α-helix | 582-584 | 3 | |
| α-helix | 586-588 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase pak 4 | A | protein | 296 | HOMO SAPIENS | O96013 (AlphaFold model) |
>2X4Z_1 SERINE/THREONINE-PROTEIN KINASE PAK 4 (chains A) GSHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLR KQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEE QIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSL VGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRL KNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
| ID | Name | Formula | Copies |
|---|---|---|---|
| 7KC | PF-3758309 | C25 H30 N8 O S | 1 |
Water and common crystallization additives (GOL) are not listed.
Small-Molecule P21-Activated Kinase Inhibitor Pf- 3758309 is a Potent Inhibitor of Oncogenic Signaling and Tumor Growth. Murray, B., Guo, C., Piraino, J. et al. Proc Natl Acad Sci U S A (2010) 107:9446. DOI 10.1073/PNAS.0911863107 · PubMed
Other PDB entries of the same protein (UniProt O96013 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2X4Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.