2X78: Human foamy virus integrase - catalytic core

Human foamy virus integrase - catalytic core. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Aug 2010.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HUMAN SPUMARETROVIRUS
Chains: 3
Atoms: 4,626
Mol. weight: 67.57 kDa
Released: 11 Aug 2010

Explore 2X78 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X78 contains 26 α-helices and 23 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	124-130	7	1
β-strand	136	1	2
β-strand	139	1	2
β-strand	141-147	7	1
β-strand	153-158	6	1
α-helix	163-173	11
β-strand	181-184	4	1
α-helix	188-191	4
α-helix	193-202	10
α-helix	204	1
β-strand	205-208	4	1
α-helix	219-236	18
α-helix	246-254	9
β-strand	258	1	3
β-strand	263	1	3
α-helix	265-270	6
α-helix	289-303	15

Chain B: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	124-130	7	4
β-strand	136	1	5
β-strand	139	1	5
β-strand	141-147	7	4
β-strand	153-158	6	4
α-helix	163-173	11
β-strand	181-184	4	4
α-helix	193-202	10
α-helix	204	1
β-strand	205-208	4	4
α-helix	220-235	16
α-helix	239-241	3
α-helix	242-254	13
α-helix	265-270	6
α-helix	289-303	15

Chain C: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	124-130	7	6
β-strand	136	1	7
β-strand	139	1	7
β-strand	141-147	7	6
β-strand	153-158	6	6
α-helix	163-173	11
β-strand	181-184	4	6
α-helix	188-191	4
α-helix	193-202	10
α-helix	204	1
β-strand	205-208	4	6
α-helix	219-234	16
α-helix	239-241	3
α-helix	242-254	13
α-helix	265-269	5
α-helix	275-276	2
α-helix	289-303	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrase	A, B, C	protein	200	HUMAN SPUMARETROVIRUS	P14350

Sequence of entity 1 (A, B, C), FASTA

>2X78_1 INTEGRASE (chains A, B, C)
GPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKS
LNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKR
LLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTRE
EELSLLQEIRTSLYHPSTPP

Primary citation

Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase. Rety, S., Rezabkova, L., Dubanchet, B. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2010) 66:881. DOI 10.1107/S1744309110022852 · PubMed

Other PDB entries of the same protein (UniProt P14350), best resolution first:

3OYM 2.02 Å, Crystal structure of the PFV N224H mutant intasome bound to manganese
2X6N 2.06 Å, Human foamy virus integrase - catalytic core. Manganese-bound structure.
3DLR 2.2 Å, Crystal structure of the catalytic core domain from PFV integrase
2X6S 2.29 Å, Human foamy virus integrase - catalytic core. Magnesium-bound structure.
2X74 2.34 Å, Human foamy virus integrase - catalytic core.
4BE2 2.38 Å, PFV intasome with inhibitor XZ-259
3S3M 2.49 Å, Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium…
3S3N 2.49 Å, Crystal structure of the Prototype Foamy Virus (PFV) S217H mutant intasome in complex…
3OYF 2.51 Å, Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium…
4BDY 2.52 Å, PFV intasome with inhibitor XZ-89
4E7I 2.53 Å, PFV intasome freeze-trapped prior to 3'-processing, Mn-bound form (UI-Mn)
3OYB 2.54 Å, Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium…

Browse structure collections

About this viewer

MolViewer shows 2X78 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.