Crystal structure of the Prototype Foamy Virus (PFV) S217H mutant intasome in complex with magnesium and Dolutegravir (S/GSK1349572). Determined by X-ray diffraction at 2.49 Å resolution. Released 13 Jul 2011.
Explore 3S3N in 3D Show helices and sheets RCSB PDB PDBe
3S3N contains 36 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-16 | 8 | |
| β-strand | 30-33 | 4 | 1 |
| β-strand | 36-41 | 6 | 1 |
| β-strand | 44-47 | 4 | 1 |
| α-helix | 51-65 | 15 | |
| α-helix | 69-77 | 9 | |
| β-strand | 80 | 1 | 1 |
| α-helix | 85-93 | 9 | |
| α-helix | 97-102 | 6 | |
| α-helix | 104-105 | 2 | |
| β-strand | 108-109 | 2 | 2 |
| α-helix | 110-113 | 4 | |
| α-helix | 115-118 | 4 | |
| β-strand | 124-130 | 7 | 3 |
| β-strand | 136 | 1 | 4 |
| β-strand | 139 | 1 | 4 |
| β-strand | 141-147 | 7 | 3 |
| β-strand | 153-158 | 6 | 3 |
| α-helix | 163-174 | 12 | |
| β-strand | 181-184 | 4 | 3 |
| α-helix | 188-191 | 4 | |
| α-helix | 193-200 | 8 | |
| α-helix | 204 | 1 | |
| β-strand | 205-208 | 4 | 3 |
| α-helix | 209-210 | 2 | |
| α-helix | 214-217 | 4 | |
| α-helix | 218-235 | 18 | |
| α-helix | 243-245 | 3 | |
| α-helix | 246-254 | 9 | |
| β-strand | 258 | 1 | 5 |
| β-strand | 263 | 1 | 5 |
| α-helix | 265-270 | 6 | |
| α-helix | 288-300 | 13 | |
| α-helix | 305-311 | 7 | |
| β-strand | 314-315 | 2 | 2 |
| β-strand | 322-325 | 4 | 6 |
| β-strand | 326 | 1 | 7 |
| α-helix | 327 | 1 | |
| α-helix | 330-331 | 2 | |
| β-strand | 337 | 1 | 7 |
| α-helix | 338-340 | 3 | |
| β-strand | 341-348 | 8 | 6 |
| β-strand | 351-355 | 5 | 6 |
| β-strand | 361-365 | 5 | 6 |
| α-helix | 366-368 | 3 | |
| β-strand | 369-371 | 3 | 6 |
| α-helix | 372 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 117-119 | 3 | |
| β-strand | 124-130 | 7 | 8 |
| β-strand | 136 | 1 | 9 |
| β-strand | 139 | 1 | 9 |
| β-strand | 141-147 | 7 | 8 |
| β-strand | 153-158 | 6 | 8 |
| α-helix | 163-173 | 11 | |
| β-strand | 181-184 | 4 | 8 |
| α-helix | 188-191 | 4 | |
| α-helix | 193-201 | 9 | |
| α-helix | 204 | 1 | |
| β-strand | 205-208 | 4 | 8 |
| α-helix | 209-210 | 2 | |
| α-helix | 219-234 | 16 | |
| α-helix | 242-254 | 13 | |
| α-helix | 257-258 | 2 | |
| α-helix | 265-270 | 6 | |
| α-helix | 288-297 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PFV integrase | A, B | protein | 395 | Human spumaretrovirus | P14350 |
| 5'-d(*ap*tp*tp*gp*tp*cp*ap*tp*gp*gp*ap*ap*tp*tp*tp*cp*gp*cp*a)-3' | C | DNA | 19 | ||
| 5'-d(*tp*gp*cp*gp*ap*ap*ap*tp*tp*cp*cp*ap*tp*gp*ap*cp*a)-3' | D | DNA | 17 |
>3S3N_1 PFV integrase (chains A, B) GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKI VLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDR PQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIA IPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVG RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQE IRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDH LGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
>3S3N_2 5'-D(*AP*TP*TP*GP*TP*CP*AP*TP*GP*GP*AP*AP*TP*TP*TP*CP*GP*CP*A)-3' (chains C) ATTGTCATGGAATTTCGCA
>3S3N_3 5'-D(*TP*GP*CP*GP*AP*AP*AP*TP*TP*CP*CP*AP*TP*GP*AP*CP*A)-3' (chains D) TGCGAAATTCCATGACA
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
| DLU | (4R,12aS)-N-(2,4-difluorobenzyl)-7-hydroxy-4-methyl-6,8-dioxo-3,4,6,8,12,12a-he… | C20 H19 F2 N3 O5 | 1 |
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (NH4, GOL, SO4) are not listed.
Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572). Hare, S., Smith, S.J., Metifiot, M. et al. Mol Pharmacol (2011) 80:565-572. DOI 10.1124/mol.111.073189 · PubMed
Other PDB entries of the same protein (UniProt P14350), best resolution first:
MolViewer shows 3S3N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.