Crystal structure of AnCE-RXPA380 complex. Determined by X-ray diffraction at 1.85 Å resolution. Released 2 Jun 2010.
Explore 2X96 in 3D Show helices and sheets RCSB PDB PDBe
2X96 contains 39 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 18-52 | 35 | |
| α-helix | 56-80 | 25 | |
| α-helix | 85-87 | 3 | |
| α-helix | 91-101 | 11 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-129 | 20 | |
| β-strand | 132 | 1 | 1 |
| β-strand | 143 | 1 | 1 |
| α-helix | 145-149 | 5 | |
| α-helix | 150-155 | 6 | |
| α-helix | 159-173 | 15 | |
| α-helix | 175-177 | 3 | |
| α-helix | 178-194 | 17 | |
| α-helix | 200-205 | 6 | |
| α-helix | 206-208 | 3 | |
| α-helix | 213-243 | 31 | |
| α-helix | 253 | 1 | |
| β-strand | 254-255 | 2 | 2 |
| α-helix | 256-258 | 3 | |
| α-helix | 268-270 | 3 | |
| α-helix | 271-274 | 4 | |
| α-helix | 286-291 | 6 | |
| α-helix | 296-309 | 14 | |
| α-helix | 313-316 | 4 | |
| α-helix | 317-322 | 6 | |
| β-strand | 324 | 1 | 3 |
| β-strand | 339-342 | 4 | 3 |
| β-strand | 349-352 | 4 | 3 |
| α-helix | 359-378 | 20 | |
| α-helix | 383-385 | 3 | |
| α-helix | 391-405 | 15 | |
| α-helix | 408-413 | 6 | |
| α-helix | 424-438 | 15 | |
| α-helix | 441-456 | 16 | |
| α-helix | 462-464 | 3 | |
| α-helix | 465-472 | 8 | |
| α-helix | 473-477 | 5 | |
| β-strand | 479-480 | 2 | 2 |
| β-strand | 485-486 | 2 | 4 |
| α-helix | 492-494 | 3 | |
| α-helix | 496-499 | 4 | |
| α-helix | 505-524 | 20 | |
| α-helix | 537-539 | 3 | |
| α-helix | 546-556 | 11 | |
| α-helix | 564-572 | 9 | |
| α-helix | 580-599 | 20 | |
| α-helix | 607-609 | 3 | |
| β-strand | 612-613 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Angiotensin converting enzyme | A | protein | 598 | DROSOPHILA MELANOGASTER | Q10714 (AlphaFold model) |
>2X96_1 ANGIOTENSIN CONVERTING ENZYME (chains A) ALVKEEIQAKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEV ASDTTKFQWRSYQSEDLKRQFKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVCDYK DSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNN FTSGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPM HLLGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLP QDFWDKSIIEKPTDGRDLVCHASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFL QYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFLTAL DKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKY HISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNML SMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKNNVHIGWTTSNKCVS
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
| ZN | Zinc ion | Zn | 1 |
| RX3 | N-({(1S,2R)-2-[(S)-[(1R)-1-{[(benzyloxy)carbonyl]amino}-2-phenylethyl](hydroxy)… | C33 H36 N3 O7 P | 1 |
Water and common crystallization additives (EPE) are not listed.
High Resolution Crystal Structures of Drosophila Melanogaster Angiotensin Converting Enzyme in Complex with Novel Inhibitors and Anti- Hypertensive Drugs. Akif, M., Georgiadis, D., Mahajan, A. et al. J Mol Biol (2010) 400:502. DOI 10.1016/J.JMB.2010.05.024 · PubMed
Other PDB entries of the same protein (UniProt Q10714 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2X96 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.