Crystal Structure of YCF48 from Thermosynechococcus elongatus. Determined by X-ray diffraction at 1.5 Å resolution. Released 13 Apr 2011.
Explore 2XBG in 3D Show helices and sheets RCSB PDB PDBe
2XBG contains 5 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 39-40 | 2 | |
| β-strand | 41 | 1 | 1 |
| α-helix | 42 | 1 | |
| β-strand | 47-51 | 5 | 2 |
| α-helix | 57 | 1 | |
| β-strand | 58-63 | 6 | 3 |
| β-strand | 69-73 | 5 | 3 |
| β-strand | 77-81 | 5 | 3 |
| β-strand | 89-90 | 2 | 3 |
| β-strand | 101-108 | 8 | 4 |
| β-strand | 111-117 | 7 | 4 |
| β-strand | 120-124 | 5 | 4 |
| β-strand | 132-133 | 2 | 4 |
| β-strand | 144-151 | 8 | 5 |
| β-strand | 154-159 | 6 | 5 |
| β-strand | 164-167 | 4 | 5 |
| β-strand | 174-178 | 5 | 5 |
| β-strand | 185-190 | 6 | 6 |
| β-strand | 196-200 | 5 | 6 |
| β-strand | 205-209 | 5 | 6 |
| β-strand | 217-220 | 4 | 6 |
| α-helix | 226 | 1 | |
| β-strand | 227-232 | 6 | 7 |
| β-strand | 238-242 | 5 | 7 |
| β-strand | 246-249 | 4 | 7 |
| β-strand | 250-251 | 2 | 8 |
| β-strand | 254-258 | 5 | 8 |
| β-strand | 262 | 1 | 7 |
| β-strand | 272-277 | 6 | 1 |
| β-strand | 283-287 | 5 | 1 |
| β-strand | 292-295 | 4 | 1 |
| β-strand | 303-304 | 2 | 1 |
| α-helix | 306-308 | 3 | |
| β-strand | 317-322 | 6 | 2 |
| β-strand | 325-329 | 5 | 2 |
| β-strand | 334-338 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| YCF48-like protein | A | protein | 327 | THERMOSYNECHOCOCCUS ELONGATUS | Q8DI95 (AlphaFold model) |
>2XBG_1 YCF48-LIKE PROTEIN (chains A) MRGSHHHHHHGLVPRGSAIPALDYNPWEAIQLPTTATILDMSFIDRHHGWLVGVNATLME TRDGGQTWEPRTLVLDHSDYRFNSVSFQGNEGWIVGEPPIMLHTTDGGQSWSQIPLDPKL PGSPRLIKALGNGSAEMITNVGAIYRTKDSGKNWQALVQEAIGVMRNLNRSPSGEYVAVS SRGSFYSTWEPGQTAWEPHNRTTSRRLHNMGFTPDGRLWMIVNGGKIAFSDPDNSENWGE LLSPLRRNSVGFLDLAYRTPNEVWLAGGAGALLCSQDGGQTWQQDVDVKKVPSNFYKILF FSPDQGFILGQKGILLRYVTDLTAAPA
Ycf48 involved in the biogenesis of the oxygen-evolving photosystem II complex is a seven-bladed beta-propeller protein. Yu, J., Knoppova, J., Michoux, F. et al. Proc Natl Acad Sci U S A (2018) 115:E7824-E7833. DOI 10.1073/pnas.1800609115 · PubMed
Other PDB entries of the same protein (UniProt Q8DI95 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2XBG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.