5OJP: YCF48

YCF48 bound to D1 peptide. Determined by X-ray diffraction at 1.86 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 1.86 Å
Organism: Thermosynechococcus elongatus
Chains: 3
Atoms: 7,331
Mol. weight: 108.25 kDa
Released: 8 Aug 2018

Explore 5OJP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5OJP contains 19 α-helices and 93 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	39-40	2
β-strand	41	1	1
α-helix	42	1
β-strand	47-51	5	2
α-helix	57	1
β-strand	58-63	6	3
β-strand	69-73	5	3
β-strand	77-81	5	3
β-strand	89-90	2	3
β-strand	101-108	8	4
β-strand	111-117	7	4
β-strand	120-124	5	4
β-strand	132-133	2	4
α-helix	134-137	4
β-strand	144-151	8	5
β-strand	154-159	6	5
β-strand	164-167	4	5
β-strand	175-178	4	5
β-strand	185-190	6	6
β-strand	196-200	5	6
β-strand	205-209	5	6
β-strand	217-220	4	6
α-helix	226	1
β-strand	227-232	6	7
β-strand	238-242	5	7
β-strand	246-249	4	7
β-strand	250-251	2	8
β-strand	254-258	5	8
α-helix	260-261	2
β-strand	262	1	7
β-strand	272-277	6	1
β-strand	283-287	5	1
β-strand	292-295	4	1
β-strand	303-304	2	1
α-helix	306-309	4
β-strand	317-322	6	2
β-strand	325-329	5	2
β-strand	334-338	5	2

Chain B: 6 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	39-40	2
β-strand	41	1	9
α-helix	42	1
β-strand	47-51	5	10
α-helix	57	1
β-strand	58-63	6	11
β-strand	69-73	5	11
β-strand	78-81	4	11
β-strand	89-90	2	11
β-strand	101-108	8	12
β-strand	111-117	7	12
β-strand	120-124	5	12
β-strand	132-133	2	12
α-helix	134-137	4
β-strand	144-151	8	13
β-strand	154-159	6	13
β-strand	164-167	4	13
β-strand	175-178	4	13
β-strand	185-190	6	14
β-strand	196-200	5	14
β-strand	205-209	5	14
β-strand	217-220	4	14
α-helix	226	1
β-strand	227-232	6	15
β-strand	238-242	5	15
β-strand	246-249	4	15
β-strand	250-251	2	16
β-strand	254-258	5	16
β-strand	262	1	15
β-strand	272-277	6	9
β-strand	283-287	5	9
β-strand	292-295	4	9
β-strand	303-304	2	9
α-helix	306-308	3
β-strand	317-322	6	10
β-strand	325-329	5	10
β-strand	334-338	5	10

Chain C: 6 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	39-40	2
β-strand	41	1	17
α-helix	42	1
β-strand	47-51	5	18
α-helix	57	1
β-strand	58-63	6	19
β-strand	69-73	5	19
β-strand	77-81	5	19
β-strand	89-90	2	19
β-strand	101-108	8	20
β-strand	111-117	7	20
β-strand	120-124	5	20
β-strand	132-133	2	20
α-helix	134-135	2
β-strand	144-151	8	21
β-strand	154-159	6	21
β-strand	164-167	4	21
β-strand	175-178	4	21
β-strand	185-190	6	22
β-strand	196-200	5	22
β-strand	206-209	4	22
β-strand	217-219	3	22
β-strand	227-232	6	23
β-strand	238-242	5	23
β-strand	246-249	4	23
β-strand	250	1	24
β-strand	258	1	24
α-helix	260-261	2
β-strand	262	1	23
β-strand	272-277	6	17
β-strand	283-287	5	17
β-strand	292-295	4	17
β-strand	303-304	2	17
α-helix	306-310	5
β-strand	315-322	8	18
β-strand	325-330	6	18
β-strand	334-338	5	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ycf48-like protein	A, B, C	protein	326	Thermosynechococcus elongatus	Q8DI95 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5OJP_1 Ycf48-like protein (chains A, B, C)
MRGSHHHHHHGLVPRGSIPALDYNPWEAIQLPTTATILDMSFIDRHHGWLVGVNATLMET
RDGGQTWEPRTLVLDHSDYRFNSVSFQGNEGWIVGEPPIMLHTTDGGQSWSQIPLDPKLP
GSPRLIKALGNGSAEMITNVGAIYRTKDSGKNWQALVQEAIGVMRNLNRSPSGEYVAVSS
EGSFYSTWEPGQTAWEPHNETTSEELHNMGFTPDGRLWMIVNGGKIAFSDPDNSENWGEL
LSPLRRNSVGFLDLAYRTPNEVWLAGGAGALLCSQDGGQTWQQDVDVKKVPSNFYKILFF
SPDQGFILGQKGILLRYVTDLTAAPA

Primary citation

Ycf48 involved in the biogenesis of the oxygen-evolving photosystem II complex is a seven-bladed beta-propeller protein. Yu, J., Knoppova, J., Michoux, F. et al. Proc Natl Acad Sci U S A (2018) 115:E7824-E7833. DOI 10.1073/pnas.1800609115 · PubMed

Other PDB entries of the same protein (UniProt Q8DI95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OJ5 1.08 Å, YCF48 bound to D1 peptide
2XBG 1.5 Å, Crystal Structure of YCF48 from Thermosynechococcus elongatus
5OJR 1.96 Å, YCF48 bound to D1 peptide

Browse structure collections

About this viewer

MolViewer shows 5OJP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.