2XHI: N-glycosylase/dna lyase

Separation-of-function mutants unravel the dual reaction mode of human 8-oxoguanine DNA glycosylase. Determined by X-ray diffraction at 1.55 Å resolution. Released 26 Jan 2011.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 3,494
Mol. weight: 49.84 kDa
Ligands: CA
Released: 26 Jan 2011

Explore 2XHI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XHI contains 21 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
β-strand	24-27	4	1
α-helix	35-38	4
β-strand	48-51	4	1
β-strand	54-59	6	1
β-strand	62-68	7	1
β-strand	72-78	7	1
α-helix	87-89	3
α-helix	90-99	10
α-helix	106-116	11
α-helix	118-126	9
α-helix	137-145	9
α-helix	152-166	15
α-helix	168	1
β-strand	169-173	5	2
β-strand	176-179	4	2
α-helix	180-183	4
α-helix	184-187	4
α-helix	192-198	7
α-helix	204-214	11
α-helix	215-219	5
α-helix	222-226	5
α-helix	227-229	3
α-helix	233-240	8
α-helix	248-258	11
α-helix	269-279	11
α-helix	293-307	15
α-helix	311-323	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
N-glycosylase/dna lyase	A	protein	360	HOMO SAPIENS	O15527 (AlphaFold model)
5'-d(gpgptpapgpapcpcptpgpgpapcpgp*c)-3'	B	DNA	15
5'-D(GPCPGPTPCPCPAP(8OG)PGPTPCPTPAPCP*C)-3'	C	DNA	15

Sequence of entity 1 (A), FASTA

>2XHI_1 N-GLYCOSYLASE/DNA LYASE (chains A)
MGSHHHHHHSQDPNSMPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSF
RWREQSPAHWSGVLADQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVT
LAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQA
FGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWL
QQLRESSYEEAHKALCILPGVGTCVADKICLMALDKPQAVPVNVHMWHIAQRDYSWHPTT
SQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG

Sequence of entity 2 (B), FASTA

>2XHI_2 5'-D(*GP*GP*TP*AP*GP*AP*CP*CP*TP*GP*GP*AP*CP*GP*C)-3' (chains B)
GGTAGACCTGGACGC

Sequence of entity 3 (C), FASTA

>2XHI_3 5'-D(*GP*CP*GP*TP*CP*CP*AP*(8OG)P*GP*TP*CP*TP*AP*CP*C)-3' (chains C)
GCGTCCAGGTCTACC

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Separation-of-Function Mutants Unravel the Dual- Reaction Mode of Human 8-Oxoguanine DNA Glycosylase. Dalhus, B., Forsbring, M., Helle, I.H. et al. Structure (2011) 19:117. DOI 10.1016/J.STR.2010.09.023 · PubMed

Other PDB entries of the same protein (UniProt O15527 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XWC 1.45 Å, Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the substrate…
5AN4 1.6 Å, Crystal structure of the human 8-oxoguanine glycosylase (OGG1) processed with the…
8XWU 1.68 Å, Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction…
8XXK 1.7 Å, Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction…
8XXG 1.82 Å, Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction…
9NZ8 1.85 Å, Crystal structure of human OGG1 in a DNA-free state
1M3Q 1.9 Å, Crystal Structure of hogg1 D268E Mutant with Base-Excised DNA and 8-aminoguanine
6RLW 2.0 Å, Structure of the human 8-oxoguanine DNA Glycosylase hOGG1 in complex with inhibitor TH5487
7AYY 2.0 Å, Structure of the human 8-oxoguanine DNA Glycosylase hOGG1 in complex with activator…
9NZ9 2.0 Å, Crystal structure of product-bound human OGG1(WT)
1LWY 2.01 Å, hOgg1 Borohydride-Trapped Intermediate without 8-oxoguanine
2NOH 2.01 Å, Structure of catalytically inactive Q315A human 8-oxoguanine glycosylase complexed to…

Browse structure collections

About this viewer

MolViewer shows 2XHI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.