2XJY: LMO2:LDB1-LID complex, P21 crystal form

Crystal structure of the LMO2:LDB1-LID complex, P21 crystal form. Determined by X-ray diffraction at 2.4 Å resolution. Released 21 Jul 2010.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,369
Mol. weight: 19.53 kDa
Ligands: ZN
Released: 21 Jul 2010

Explore 2XJY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XJY contains 7 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	29	1	1
β-strand	30	1	2
β-strand	36	1	1
β-strand	41-45	5	2
β-strand	48-51	4	2
β-strand	56	1	3
β-strand	63	1	3
β-strand	71-74	4	4
β-strand	77-79	3	4
α-helix	81-88	8
α-helix	89-91	3
β-strand	92-93	2	5
β-strand	100-101	2	5
β-strand	106-110	5	6
β-strand	113-116	4	6
α-helix	117-119	3
β-strand	121	1	7
α-helix	127	1
β-strand	128	1	7
α-helix	129	1
β-strand	134-138	5	8
β-strand	141-144	4	8
α-helix	145-147	3
α-helix	148-155	8

Chain B: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	338-339	2	8
β-strand	344-345	2	6
β-strand	355-356	2	4
β-strand	359-362	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rhombotin-2	A	protein	131	HOMO SAPIENS	P25791 (AlphaFold model)
Lim domain-binding protein 1	B	protein	35	HOMO SAPIENS	Q86U70 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2XJY_1 RHOMBOTIN-2 (chains A)
SLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYL
RLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCE
QDIYEWTKING

Sequence of entity 2 (B), FASTA

>2XJY_2 LIM DOMAIN-BINDING PROTEIN 1 (chains B)
VPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structure of the Leukemia Oncogene Lmo2: Implications for the Assembly of a Hematopoietic Transcription Factor Complex. El Omari, K., Hoosdally, S.J., Tuladhar, K. et al. Blood (2011) 117:2146. DOI 10.1182/BLOOD-2010-07-293357 · PubMed

Other PDB entries of the same protein (UniProt P25791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XJZ 2.8 Å, Crystal structure of the LMO2:LDB1-LID complex, C2 crystal form
2YPA 2.8 Å, Structure of the SCL:E47:LMO2:LDB1 complex bound to DNA
4KFZ 2.8 Å, Crystal structure of LMO2 and anti-LMO2 VH complex

Browse structure collections

About this viewer

MolViewer shows 2XJY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.