2XN4: Kelch domain of human KLHL2

Crystal structure of the kelch domain of human KLHL2 (Mayven). Determined by X-ray diffraction at 1.99 Å resolution. Released 18 Aug 2010.

Method: X-ray diffraction
Resolution: 1.99 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 4,897
Mol. weight: 66.41 kDa
Released: 18 Aug 2010

Explore 2XN4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XN4 contains 13 α-helices and 82 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	307-312	6	1
β-strand	315	1	2
β-strand	319	1	2
β-strand	323-327	5	1
β-strand	332-336	5	1
α-helix	337-339	3
β-strand	344	1	3
β-strand	347-351	5	4
β-strand	354-358	5	4
β-strand	361	1	3
β-strand	366	1	3
β-strand	370-374	5	4
β-strand	379-383	5	4
α-helix	384-386	3
β-strand	391	1	5
β-strand	394-398	5	5
β-strand	401-408	8	5
β-strand	413-421	9	5
β-strand	426-430	5	5
α-helix	431-433	3
β-strand	438	1	6
β-strand	441-445	5	7
β-strand	448-452	5	7
β-strand	455-456	2	6
β-strand	461-462	2	6
β-strand	466-470	5	7
β-strand	475-479	5	7
α-helix	480-482	3
β-strand	487	1	8
β-strand	490-494	5	9
β-strand	497-501	5	9
β-strand	504	1	8
β-strand	509	1	8
α-helix	510	1
β-strand	513-517	5	9
β-strand	522-526	5	9
α-helix	527-529	3
β-strand	534	1	10
β-strand	537-541	5	11
β-strand	544-548	5	11
β-strand	551	1	10
β-strand	556	1	10
β-strand	560-564	5	11
β-strand	569-572	4	11
α-helix	576-577	2
β-strand	582	1	2
β-strand	585-590	6	1

Chain B: 6 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	307-312	6	12
β-strand	315	1	13
β-strand	319	1	13
β-strand	323-327	5	12
β-strand	332-336	5	12
β-strand	344	1	14
β-strand	347-351	5	15
β-strand	354-358	5	15
β-strand	361	1	14
β-strand	366	1	14
β-strand	370-374	5	15
β-strand	379-383	5	15
α-helix	384-386	3
β-strand	391	1	16
β-strand	394-398	5	17
β-strand	401-405	5	17
β-strand	408	1	16
β-strand	413	1	16
β-strand	417-421	5	17
β-strand	426-430	5	17
α-helix	431-433	3
β-strand	438	1	18
β-strand	441-445	5	19
β-strand	448-452	5	19
β-strand	455-456	2	18
β-strand	461-462	2	18
β-strand	466-470	5	19
β-strand	475-478	4	19
α-helix	480-482	3
β-strand	487	1	20
β-strand	490-494	5	21
β-strand	497-501	5	21
β-strand	504	1	20
β-strand	509	1	20
α-helix	510	1
β-strand	513-517	5	21
β-strand	522-526	5	21
α-helix	527-529	3
β-strand	534	1	22
β-strand	537-541	5	23
β-strand	544-548	5	23
β-strand	551	1	22
β-strand	556	1	22
β-strand	560-564	5	23
β-strand	569-572	4	23
α-helix	576-577	2
β-strand	582	1	13
β-strand	585-590	6	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kelch-like protein 2	A, B	protein	302	HOMO SAPIENS	O95198 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2XN4_1 KELCH-LIKE PROTEIN 2 (chains A, B)
SMSVRTRLRTPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYM
AGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGS
TGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNA
TTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNM
CRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSCMSTGRSYAGVTVIDK
RL

Primary citation

Structural Basis for Cul3 Assembly with the Btb-Kelch Family of E3 Ubiquitin Ligases. Canning, P., Cooper, C.D.O., Krojer, T. et al. J Biol Chem (2013) 288:7803. DOI 10.1074/JBC.M112.437996 · PubMed

Other PDB entries of the same protein (UniProt O95198 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CHB 1.56 Å, Crystal structure of the human KLHL2 Kelch domain in complex with a WNK4 peptide

Browse structure collections

About this viewer

MolViewer shows 2XN4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.