4CHB: Human KLHL2 Kelch domain

Crystal structure of the human KLHL2 Kelch domain in complex with a WNK4 peptide. Determined by X-ray diffraction at 1.56 Å resolution. Released 8 Jan 2014.

Method: X-ray diffraction
Resolution: 1.56 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 4,992
Mol. weight: 69.58 kDa
Released: 8 Jan 2014

Explore 4CHB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CHB contains 14 α-helices and 88 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 44 β-strands

Element	Residues	Length	Sheet
β-strand	307-312	6	1
β-strand	315	1	2
β-strand	319	1	2
β-strand	320	1	3
β-strand	323-327	5	1
β-strand	332-335	4	1
α-helix	338-339	2
β-strand	343	1	3
β-strand	344	1	4
β-strand	347-351	5	5
β-strand	354-358	5	5
β-strand	361	1	4
β-strand	366	1	4
β-strand	370-374	5	5
β-strand	379-383	5	5
α-helix	384-386	3
β-strand	391	1	6
β-strand	394-398	5	7
β-strand	401-405	5	7
β-strand	408	1	6
β-strand	413	1	6
β-strand	417-421	5	7
β-strand	426-430	5	7
α-helix	431-433	3
β-strand	438	1	8
β-strand	441-445	5	9
β-strand	448-452	5	9
β-strand	455-456	2	8
β-strand	461-462	2	8
β-strand	466-470	5	9
β-strand	475-478	4	9
α-helix	480-482	3
β-strand	487	1	10
β-strand	490-494	5	11
β-strand	497-501	5	11
β-strand	504-505	2	10
β-strand	508-509	2	10
β-strand	513-517	5	11
β-strand	522-525	4	11
α-helix	527-529	3
β-strand	534	1	12
β-strand	537-541	5	13
β-strand	544-548	5	13
β-strand	551	1	12
β-strand	556	1	12
β-strand	560-564	5	13
β-strand	569-572	4	13
α-helix	576-577	2
β-strand	582	1	2
β-strand	585-590	6	1

Chain B: 6 helices, 44 β-strands

Element	Residues	Length	Sheet
β-strand	307-312	6	14
β-strand	315	1	15
β-strand	319	1	15
β-strand	320	1	16
β-strand	323-327	5	14
β-strand	332-336	5	14
α-helix	338-339	2
β-strand	343	1	16
β-strand	344	1	17
β-strand	347-351	5	18
β-strand	354-358	5	18
β-strand	361	1	17
β-strand	366	1	17
β-strand	370-374	5	18
β-strand	379-383	5	18
α-helix	384-386	3
β-strand	391	1	19
β-strand	394-398	5	20
β-strand	401-405	5	20
β-strand	408	1	19
β-strand	413	1	19
β-strand	417-421	5	20
β-strand	426-430	5	20
α-helix	431-433	3
β-strand	438	1	21
β-strand	441-445	5	22
β-strand	448-452	5	22
β-strand	455-456	2	21
β-strand	461-462	2	21
β-strand	466-470	5	22
β-strand	475-478	4	22
α-helix	480-482	3
β-strand	487	1	23
β-strand	490-494	5	24
β-strand	497-501	5	24
β-strand	504-505	2	23
β-strand	508-509	2	23
β-strand	513-517	5	24
β-strand	522-525	4	24
α-helix	527-529	3
β-strand	534	1	25
β-strand	537-541	5	26
β-strand	544-548	5	26
β-strand	551	1	25
β-strand	556	1	25
β-strand	560-564	5	26
β-strand	569-572	4	26
α-helix	576-577	2
β-strand	582	1	15
β-strand	585-590	6	14

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	562-564	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kelch-like protein 2	A, B	protein	302	HOMO SAPIENS	O95198 (AlphaFold model)
Serine/threonine-protein kinase WNK4	C, D	protein	11	HOMO SAPIENS	Q96J92 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4CHB_1 KELCH-LIKE PROTEIN 2 (chains A, B)
SMSVRTRLRTPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYM
AGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGS
TGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNA
TTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNM
CRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSCMSTGRSYAGVTVIDK
RL

Sequence of entity 2 (C, D), FASTA

>4CHB_2 SERINE/THREONINE-PROTEIN KINASE WNK4 (chains C, D)
EPEEPEADQHQ

Primary citation

Structural and Biochemical Characterisation of the Klhl3-Wnk Kinase Interaction Important in Blood Pressure Regulation. Schumacher, F., Sorrell, F.J., Alessi, D.R. et al. Biochem J (2014) 460:237. DOI 10.1042/BJ20140153 · PubMed

Other PDB entries of the same protein (UniProt O95198 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XN4 1.99 Å, Crystal structure of the kelch domain of human KLHL2 (Mayven)

Browse structure collections

About this viewer

MolViewer shows 4CHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.