2XPX: BHRF1:Bak BH3 complex

Name: PDB 2XPX: Crystal structure of BHRF1:Bak BH3 complex
Published: 2011-01-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Crystal structure of BHRF1:Bak BH3 complex. Determined by X-ray diffraction at 2.05 Å resolution. Released 26 Jan 2011.

Method: X-ray diffraction
Resolution: 2.05 Å
Organisms: HUMAN HERPESVIRUS 4, HOMO SAPIENS
Chains: 2
Atoms: 1,534
Mol. weight: 23.1 kDa
Released: 26 Jan 2011

Explore 2XPX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XPX contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	5-20	16
α-helix	27-35	9
α-helix	45-60	16
α-helix	62-75	14
α-helix	79-91	13
α-helix	98-117	20
α-helix	123-137	15
α-helix	138-140	3
α-helix	141-146	6
α-helix	150-155	6

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	70-89	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis regulator BHRF1	A	protein	173	HUMAN HERPESVIRUS 4	P03182 (AlphaFold model)
Bcl-2 homologous antagonist/killer	B	protein	26	HOMO SAPIENS	Q16611 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2XPX_1 APOPTOSIS REGULATOR BHRF1 (chains A)
MGSHHHHHHSQDPMAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVV
LRYHVLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAW
CMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG

Sequence of entity 2 (B), FASTA

>2XPX_2 BCL-2 HOMOLOGOUS ANTAGONIST/KILLER (chains B)
PSSTMGQVGRQLAIIGDDINRRYDSE

Primary citation

Structural Basis for Apoptosis Inhibition by Epstein-Barr Virus Bhrf1. Kvansakul, M., Wei, A.H., Fletcher, J.I. et al. PLoS Pathog (2010) 6:1236. DOI 10.1371/JOURNAL.PPAT.1001236 · PubMed

Other PDB entries of the same protein (UniProt P03182 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P9W 2.0 Å, Epstein-Barr virus encoded apoptosis regulator BHRF1 in complex with Puma BH3
8SM5 2.61 Å, Crystal Structure of BHRF1 from Epstein Barr Virus in complex with BID BH3 peptide
7P33 2.79 Å, Epstein-Barr virus encoded Bcl-2 homolog BHRF-1 in complex with Bid BH3 peptide
1Q59 Solution Structure of the BHRF1 Protein From Epstein-Barr Virus, a Homolog of Human Bcl-2

Browse structure collections

About this viewer

MolViewer shows 2XPX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.