2XQW: Factor H domains 19-20

Structure of Factor H domains 19-20 in complex with complement C3d. Determined by X-ray diffraction at 2.31 Å resolution. Released 2 Feb 2011.

Method: X-ray diffraction
Resolution: 2.31 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 5,700
Mol. weight: 80.78 kDa
Released: 2 Feb 2011

Explore 2XQW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XQW contains 38 α-helices and 28 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	20-38	19
α-helix	41-44	4
α-helix	47-63	17
α-helix	64-66	3
β-strand	67	1	1
β-strand	73	1	1
α-helix	80-82	3
α-helix	83-96	14
α-helix	104-113	10
α-helix	114-118	5
β-strand	119	1	2
β-strand	125	1	2
α-helix	138-140	3
α-helix	146-160	15
α-helix	162-165	4
α-helix	172-186	15
α-helix	193-206	14
α-helix	212-218	7
β-strand	222	1	3
β-strand	226	1	3
α-helix	233-249	17
α-helix	256-265	10
α-helix	276-291	16

Chain B: 15 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	20-37	18
α-helix	41-44	4
α-helix	48-63	16
α-helix	64-66	3
β-strand	67	1	4
β-strand	73	1	4
α-helix	83-94	12
α-helix	104-118	15
β-strand	119	1	5
β-strand	125	1	5
α-helix	134-141	8
α-helix	146-165	20
α-helix	172-187	16
α-helix	193-206	14
α-helix	211-220	10
β-strand	222	1	6
β-strand	226	1	6
α-helix	233-249	17
α-helix	256-265	10
α-helix	276-291	16

Chain C: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	1112-1114	3
β-strand	1118-1120	3	7
β-strand	1133-1135	3	8
β-strand	1136-1138	3	7
α-helix	1139	1
β-strand	1143-1145	3	9
β-strand	1149-1151	3	8
β-strand	1152-1153	2	10
β-strand	1156-1157	2	10
α-helix	1158	1
β-strand	1162-1164	3	9
β-strand	1167-1170	4	11
α-helix	1171-1176	6
β-strand	1179-1181	3	12
β-strand	1188-1191	4	11
β-strand	1196-1198	3	13
β-strand	1199-1201	3	12
β-strand	1215-1217	3	13
β-strand	1218-1219	2	14
β-strand	1222-1223	2	14
α-helix	1224-1227	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C3	A, B	protein	294	HOMO SAPIENS	P01024 (AlphaFold model)
Complement factor H	C	protein	133	HOMO SAPIENS	P08603 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2XQW_1 COMPLEMENT C3 (chains A, B)
MLDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGY
TQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQK
PDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAG
DFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEAT
SYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP

Sequence of entity 2 (C), FASTA

>2XQW_2 COMPLEMENT FACTOR H (chains C)
AGIQKDSTGKCGPPPPIDNGGITSFPLSVYAPASSVEYQCANLYQLEGNKRITCRNGQWS
EPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTC
WDGKLEYPTCAKR

Primary citation

Dual Interaction of Factor H with C3D and Glycosaminoglycans in Host-Nonhost Discrimination by Complement. Kajander, T., Lehtinen, M.J., Hyvarinen, S. et al. Proc Natl Acad Sci U S A (2011) 108:2897. DOI 10.1073/PNAS.1017087108 · PubMed

Other PDB entries of the same protein (UniProt P01024 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WY7 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
2WY8 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
7UE9 1.75 Å, Structure of anti-C3d Fab(3d8b) in complex with C3d
1C3D 1.8 Å, X-ray crystal structure of C3D: a C3 fragment and ligand for complement receptor 2
6RMT 2.0 Å, Crystal structure of disulphide-linked human C3d dimer
7BAG 2.0 Å, C3b in complex with CP40
1GHQ 2.04 Å, CR2-C3D complex structure
3D5R 2.1 Å, Crystal Structure of Efb-C (N138A) / C3d Complex
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4I6O 2.14 Å, Crystal structure of chemically synthesized human anaphylatoxin C3a
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
2GOX 2.2 Å, Crystal structure of Efb-C / C3d Complex

Browse structure collections

About this viewer

MolViewer shows 2XQW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.