2XV4: Human RPC62

Name: PDB 2XV4: Structure of Human RPC62 (partial)
Published: 2011-03-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structure of Human RPC62 (partial). Determined by X-ray diffraction at 2.95 Å resolution. Released 2 Mar 2011.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 3,217
Mol. weight: 60.98 kDa
Ligands: PO4
Released: 2 Mar 2011

Explore 2XV4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XV4 contains 22 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain S: 22 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	3-17	15
α-helix	19-30	12
β-strand	34-35	2	1
α-helix	36-43	8
α-helix	47-59	13
β-strand	63-68	6	1
β-strand	72-77	6	1
α-helix	79-83	5
α-helix	84-87	4
α-helix	88-98	11
α-helix	101-113	13
β-strand	116	1	2
α-helix	118-130	13
α-helix	141-153	13
β-strand	157-159	3	2
α-helix	160-161	2
β-strand	235-237	3	2
α-helix	239-258	20
α-helix	262-273	12
α-helix	285-287	3
β-strand	288-289	2	3
α-helix	290-295	6
α-helix	304-315	12
β-strand	322	1	4
β-strand	333-334	2	3
β-strand	336	1	4
α-helix	338-358	21
α-helix	360-368	9
α-helix	428-455	28
α-helix	458-472	15
α-helix	484-488	5
α-helix	493-529	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase III subunit RPC3	S	protein	534	HOMO SAPIENS	Q9BUI4 (AlphaFold model)

Sequence of entity 1 (S), FASTA

>2XV4_1 DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC3 (chains S)
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQH
NLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSA
VVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTL
VINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLD
RFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVG
YNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGS
RCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT
FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAE
EAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	3

Primary citation

Structure-Function Analysis of Hrpc62 Provides Insights Into RNA Polymerase III Transcription. Lefevre, S., Dumay-Odelot, H., El Ayoubi, L. et al. Nat Struct Mol Biol (2011) 18:352. DOI 10.1038/NSMB.1996 · PubMed

Other PDB entries of the same protein (UniProt Q9BUI4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XUB 2.8 Å, Human RPC62 subunit structure
7AE1 2.8 Å, Cryo-EM structure of human RNA Polymerase III elongation complex 1
9K39 2.8 Å, Human RNA Polymerase III de novo transcribing complex 8 (TC8)
7D58 2.9 Å, cryo-EM structure of human RNA polymerase III in elongating state
9K36 2.9 Å, Human RNA Polymerase III de novo transcribing complex 12 (TC12)
9K2G 3.0 Å, Human RNA Polymerase III de novo transcribing complex 13 (TC13)
9K3U 3.0 Å, Human RNA Polymerase III de novo transcribing complex 5 (TC5)
7AE3 3.1 Å, Cryo-EM structure of human RNA Polymerase III elongation complex 3
7D59 3.1 Å, cryo-EM structure of human RNA polymerase III in apo state
9K38 3.1 Å, Human RNA Polymerase III de novo transcribing complex 6 (TC6)
9FSO 3.28 Å, Human RNA Polymerase III Class III Open Pre-initiation Complex 1 (OC1)
7A6H 3.3 Å, Cryo-EM structure of human apo RNA Polymerase III

Browse structure collections

About this viewer

MolViewer shows 2XV4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.