2Y5Y: LacY

Crystal structure of LacY in complex with an affinity inactivator. Determined by X-ray diffraction at 3.38 Å resolution. Released 15 Jun 2011.

Method: X-ray diffraction
Resolution: 3.38 Å
Organism: ESCHERICHIA COLI
Chains: 2
Atoms: 6,209
Mol. weight: 95.3 kDa
Ligands: BA, TGA
Released: 15 Jun 2011

Explore 2Y5Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Y5Y contains 59 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 0 β-strands

Element	Residues	Length
α-helix	7-26	20
α-helix	30-32	3
α-helix	33-37	5
α-helix	42-69	28
α-helix	71-73	3
α-helix	75-85	11
α-helix	88-90	3
α-helix	91-95	5
α-helix	96-100	5
α-helix	104-119	16
α-helix	121-135	15
α-helix	140-175	36
α-helix	176-180	5
α-helix	183-186	4
α-helix	210-218	9
α-helix	220-228	9
α-helix	229-234	6
α-helix	235-241	7
α-helix	243-249	7
α-helix	254-286	33
α-helix	288-306	19
α-helix	312-325	14
α-helix	327-340	14
α-helix	343-345	3
α-helix	346-349	4
α-helix	350-357	8
α-helix	358-375	18
α-helix	377-399	23
α-helix	401-402	2

Chain B: 30 helices, 0 β-strands

Element	Residues	Length
α-helix	7-26	20
α-helix	30-32	3
α-helix	33-37	5
α-helix	42-69	28
α-helix	71-73	3
α-helix	75-85	11
α-helix	88-90	3
α-helix	91-95	5
α-helix	96-100	5
α-helix	104-112	9
α-helix	116-119	4
α-helix	121-135	15
α-helix	140-175	36
α-helix	176-180	5
α-helix	181-186	6
α-helix	210-218	9
α-helix	220-228	9
α-helix	229-234	6
α-helix	235-241	7
α-helix	243-249	7
α-helix	254-286	33
α-helix	288-306	19
α-helix	312-325	14
α-helix	327-340	14
α-helix	343-345	3
α-helix	346-349	4
α-helix	350-357	8
α-helix	358-375	18
α-helix	377-395	19
α-helix	396-398	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lactose permease	A, B	protein	423	ESCHERICHIA COLI	P02920 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2Y5Y_1 LACTOSE PERMEASE (chains A, B)
MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDTGIIFAAISLFSLLFQ
PLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNILVGSIVGGIYLGFSFNA
GCPAVEAFIEKVSRRSNFEFGRARMFGAVGWALVASIVGIMFTINNQFVFWLGSGMALIL
AVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKLWFLSLYVIGVSSTYDVFD
QQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPLIINRIGGKNALLLAGTIMS
VRIIGSSFATSALEVVILKTLHMFEVPFLLVGSFKYITSQFEVRFSATIYLVAFAFFKQL
AMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFTLSGPGPLSLLRRQVNEVAHHH
HHH

Ligands and cofactors

ID	Name	Formula	Copies
BA	Barium ion	Ba	2
TGA	2-sulfanylethyl beta-D-galactopyranoside	C8 H16 O6 S	2

Primary citation

Crystal Structure of Lactose Permease in Complex with an Affinity Inactivator Yields Unique Insight Into Sugar Recognition. Chaptal, V., Kwon, S., Sawaya, M.R. et al. Proc Natl Acad Sci U S A (2011) 108:9361. DOI 10.1073/PNAS.1105687108 · PubMed

Other PDB entries of the same protein (UniProt P02920 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9XOU 2.5 Å, CryoEM structure of LacY with Trimbody
6VBG 2.8 Å, Lactose permease complex with thiodigalactoside and nanobody 9043
2CFQ 2.95 Å, Sugar Free Lactose Permease at neutral pH
8YA0 2.97 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C)
6C9W 3.0 Å, Crystal Structure of a ligand bound LacY/Nanobody Complex
8YA3 3.27 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C) treated with DTT
8Y9Y 3.29 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+1C)
2CFP 3.3 Å, Sugar Free Lactose Permease at acidic pH
5GXB 3.3 Å, crystal structure of a LacY/Nanobody complex
4ZYR 3.31 Å, Crystal structure of E. coli Lactose permease G46W/G262W bound to p-nitrophenyl…
1PV6 3.5 Å, Crystal structure of lactose permease
4OAA 3.5 Å, Crystal structure of E. coli lactose permease G46W,G262W bound to sugar

Browse structure collections

About this viewer

MolViewer shows 2Y5Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.