2Y7Y: Aplysia californica achbp in apo state

Name: PDB 2Y7Y: Aplysia californica achbp in apo state
Published: 2011-03-23
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: receptor

Aplysia californica achbp in apo state. Determined by X-ray diffraction at 1.9 Å resolution. Released 23 Mar 2011.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: APLYSIA CALIFORNICA
Chains: 5
Atoms: 9,462
Mol. weight: 123.44 kDa
Released: 23 Mar 2011

Explore 2Y7Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Y7Y contains 24 α-helices and 79 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
β-strand	27-42	16	1
β-strand	47-64	18	1
α-helix	67-69	3
β-strand	75-79	5	1
α-helix	80-82	3
β-strand	88-90	3	2
β-strand	93	1	1
β-strand	98-99	2	1
β-strand	104-108	5	1
β-strand	110-115	6	1
β-strand	118-124	7	1
β-strand	136-144	9	2
β-strand	152-155	4	1
β-strand	160	1	2
β-strand	162	1	1
β-strand	172-184	13	2
β-strand	193-204	12	2

Chain B: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
α-helix	9-13	5
α-helix	16-18	3
β-strand	27-42	16	3
β-strand	47-64	18	3
α-helix	67-69	3
β-strand	75-79	5	3
α-helix	80-82	3
β-strand	88-90	3	4
β-strand	93	1	3
α-helix	96-97	2
β-strand	98-99	2	3
β-strand	104-108	5	3
β-strand	110-115	6	3
β-strand	118-124	7	3
β-strand	136-144	9	4
β-strand	152-155	4	3
β-strand	160	1	4
β-strand	162	1	3
β-strand	172-184	13	4
β-strand	193-204	12	4

Chain C: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
β-strand	27-42	16	5
β-strand	47-64	18	5
α-helix	67-70	4
β-strand	75-79	5	5
α-helix	80-82	3
β-strand	88-90	3	6
β-strand	93	1	5
α-helix	96-97	2
β-strand	98-99	2	5
β-strand	104-108	5	5
β-strand	110-115	6	5
β-strand	118-124	7	5
β-strand	136-144	9	6
β-strand	152-155	4	5
β-strand	160	1	6
β-strand	162	1	5
β-strand	172-183	12	6
β-strand	194-204	11	6

Chain D: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
α-helix	16-18	3
β-strand	22	1	7
β-strand	25	1	7
β-strand	27-42	16	8
β-strand	47-64	18	8
α-helix	67-70	4
β-strand	75-79	5	8
α-helix	80-82	3
β-strand	88-90	3	9
β-strand	93	1	8
α-helix	96-97	2
β-strand	98-99	2	8
β-strand	104-108	5	8
β-strand	110-115	6	8
β-strand	118-124	7	8
β-strand	136-144	9	9
β-strand	152-155	4	8
β-strand	160	1	9
α-helix	161	1
β-strand	162	1	8
β-strand	172-184	13	9
β-strand	193-204	12	9

Chain E: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
α-helix	16-18	3
β-strand	22	1	10
β-strand	25	1	10
β-strand	27-42	16	11
β-strand	47-64	18	11
α-helix	67-70	4
β-strand	75-79	5	11
α-helix	80-82	3
β-strand	88-90	3	12
β-strand	93	1	11
α-helix	96-97	2
β-strand	98-99	2	11
β-strand	104-108	5	11
β-strand	110-115	6	11
β-strand	118-124	7	11
β-strand	136-144	9	12
β-strand	152-155	4	11
β-strand	160	1	12
β-strand	162	1	11
β-strand	172-184	13	12
β-strand	193-204	12	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble acetylcholine receptor	A, B, C, D, E	protein	217	APLYSIA CALIFORNICA	Q8WSF8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>2Y7Y_1 SOLUBLE ACETYLCHOLINE RECEPTOR (chains A, B, C, D, E)
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKL
NSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQR
LSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQT
RQVQHYSCCPEPYIDVNLVVKFRERRAGNGFFRNLFD

Primary citation

Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X-Ray Analysis. Ulens, C., Akdemir, A., Jongejan, A. et al. J Med Chem (2009) 52:2372. DOI 10.1021/JM801400G · PubMed

Other PDB entries of the same protein (UniProt Q8WSF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6T9R 1.72 Å, Aplysia californica AChBP in complex with a cytisine derivative
2WN9 1.75 Å, Crystal structure of Aplysia ACHBP in complex with 4-0H-DMXBA
2PGZ 1.76 Å, Crystal structure of Cocaine bound to an ACh-Binding Protein
2WNJ 1.8 Å, Crystal structure of aplysia achbp in complex with dmxba
8QTL 1.85 Å, Aplysia californica acetylcholine-binding protein in complex with Spiroimine (-)-4 S
4XHE 1.9 Å, Crystal Structure of A-AChBP in complex with pinnatoxin A
4ZK4 1.9 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
2XYS 1.91 Å, Crystal structure of Aplysia californica AChBP in complex with strychnine
5TVC 1.93 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
3C84 1.94 Å, Crystal structure of a complex of AChBP from aplysia californica and the neonicotinoid…
2YMD 1.96 Å, Crystal structure of a mutant binding protein (5HTBP-AChBP) in complex with serotonin…
4WV9 2.0 Å, Crystal structure of acetylcholine binding protein (AChBP) from Aplysia Californica in…

Browse structure collections

About this viewer

MolViewer shows 2Y7Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.