4XHE: A-AChBP

Crystal Structure of A-AChBP in complex with pinnatoxin A. Determined by X-ray diffraction at 1.9 Å resolution. Released 3 Jun 2015.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Aplysia californica
Chains: 10
Atoms: 19,628
Mol. weight: 254.59 kDa
Ligands: CA, 40P
Released: 3 Jun 2015

Explore 4XHE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XHE contains 45 α-helices and 162 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	-6-11	18
α-helix	12-16	5
β-strand	24	1	1
β-strand	27	1	1
β-strand	29-44	16	2
β-strand	49-66	18	2
α-helix	69-72	4
β-strand	77-81	5	2
α-helix	82-84	3
β-strand	90-92	3	3
β-strand	95	1	2
β-strand	100-101	2	2
β-strand	106-110	5	2
β-strand	112-117	6	2
β-strand	120-126	7	2
β-strand	138-146	9	3
β-strand	154-157	4	2
β-strand	162	1	3
β-strand	164	1	2
β-strand	174-186	13	3
β-strand	195-206	12	3

Chain B: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	-4--1	4
α-helix	2-10	9
α-helix	11-16	6
β-strand	24	1	4
β-strand	27	1	4
β-strand	29-44	16	5
β-strand	49-61	13	5
α-helix	63-65	3
α-helix	69-71	3
β-strand	77-81	5	5
α-helix	82-84	3
β-strand	90-92	3	6
β-strand	95	1	5
β-strand	100-101	2	5
β-strand	106-110	5	5
β-strand	114-117	4	5
β-strand	120-126	7	5
β-strand	138-146	9	6
β-strand	154-157	4	5
β-strand	162	1	6
β-strand	164	1	5
β-strand	174-186	13	6
β-strand	195-206	12	6

Chain C: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	-1-10	12
α-helix	11-15	5
α-helix	18-20	3
β-strand	29-44	16	7
β-strand	49-66	18	7
α-helix	69-72	4
β-strand	77-81	5	7
α-helix	82-84	3
β-strand	90-92	3	8
β-strand	95	1	7
β-strand	100-101	2	7
β-strand	106-110	5	7
β-strand	112-117	6	7
β-strand	120-126	7	7
β-strand	138-146	9	8
β-strand	154-157	4	7
β-strand	162	1	8
α-helix	163	1
β-strand	164	1	7
β-strand	174-186	13	8
β-strand	195-206	12	8

Chain D: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	-1-15	17
α-helix	18-20	3
β-strand	29-44	16	9
β-strand	49-66	18	9
α-helix	69-72	4
β-strand	77-81	5	9
α-helix	82-84	3
β-strand	90-92	3	10
β-strand	95	1	9
β-strand	100-101	2	9
β-strand	106-110	5	9
β-strand	112-117	6	9
β-strand	120-126	7	9
β-strand	138-146	9	10
β-strand	154-157	4	9
β-strand	162	1	10
β-strand	164	1	9
β-strand	174-186	13	10
β-strand	195-206	12	10

Chain E: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	-1-14	16
β-strand	24	1	11
β-strand	27	1	11
β-strand	29-44	16	12
β-strand	49-66	18	12
α-helix	69-72	4
β-strand	77-81	5	12
α-helix	82-84	3
β-strand	90-92	3	13
β-strand	95	1	12
β-strand	100-101	2	12
β-strand	106-110	5	12
β-strand	112-117	6	12
β-strand	120-126	7	12
β-strand	138-146	9	13
β-strand	154-157	4	12
β-strand	162	1	13
α-helix	163	1
β-strand	164	1	12
β-strand	174-186	13	13
β-strand	195-206	12	13

Chain F: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	-3-14	18
α-helix	18-20	3
β-strand	24	1	14
β-strand	27	1	14
β-strand	29-44	16	15
β-strand	49-66	18	15
α-helix	69-72	4
β-strand	77-81	5	15
α-helix	82-84	3
β-strand	90-92	3	16
β-strand	95	1	15
β-strand	100-101	2	15
β-strand	106-110	5	15
β-strand	112-117	6	15
β-strand	120-126	7	15
β-strand	138-146	9	16
β-strand	154-157	4	15
β-strand	162	1	16
β-strand	164	1	15
β-strand	174-188	15	16
β-strand	191-206	16	16

Chain G: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	-1-14	16
β-strand	29-44	16	17
β-strand	49-66	18	17
α-helix	69-72	4
β-strand	77-81	5	17
α-helix	82-84	3
β-strand	90-92	3	18
β-strand	95	1	17
β-strand	100-101	2	17
β-strand	106-110	5	17
β-strand	112-117	6	17
β-strand	120-126	7	17
β-strand	138-146	9	18
β-strand	154-157	4	17
β-strand	162	1	18
α-helix	163	1
β-strand	164	1	17
β-strand	174-186	13	18
β-strand	195-206	12	18

Chain H: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-15	14
α-helix	18-20	3
β-strand	29-44	16	19
β-strand	49-66	18	19
α-helix	69-72	4
β-strand	77-81	5	19
α-helix	82-84	3
β-strand	90-92	3	20
β-strand	95	1	19
β-strand	100-101	2	19
β-strand	106-110	5	19
β-strand	112-117	6	19
β-strand	120-126	7	19
β-strand	138-146	9	20
β-strand	154-157	4	19
β-strand	162	1	20
α-helix	163	1
β-strand	164	1	19
β-strand	174-186	13	20
β-strand	195-206	12	20

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble acetylcholine receptor	A, B, C, D, E, F, G, H, I, J	protein	217	Aplysia californica	Q8WSF8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>4XHE_1 Soluble acetylcholine receptor (chains A, B, C, D, E, F, G, H, I, J)
DYKDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVD
LVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTH
DGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYAS
SKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3
40P	Pinnatoxin A	C41 H61 N O9	10

Water and common crystallization additives (CL) are not listed.

Primary citation

Marine Macrocyclic Imines, Pinnatoxins A and G: Structural Determinants and Functional Properties to Distinguish Neuronal alpha 7 from Muscle alpha 12 beta gamma delta nAChRs. Bourne, Y., Sulzenbacher, G., Radic, Z. et al. Structure (2015) 23:1106-1115. DOI 10.1016/j.str.2015.04.009 · PubMed

Other PDB entries of the same protein (UniProt Q8WSF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6T9R 1.72 Å, Aplysia californica AChBP in complex with a cytisine derivative
2WN9 1.75 Å, Crystal structure of Aplysia ACHBP in complex with 4-0H-DMXBA
2PGZ 1.76 Å, Crystal structure of Cocaine bound to an ACh-Binding Protein
2WNJ 1.8 Å, Crystal structure of aplysia achbp in complex with dmxba
8QTL 1.85 Å, Aplysia californica acetylcholine-binding protein in complex with Spiroimine (-)-4 S
2Y7Y 1.9 Å, Aplysia californica achbp in apo state
4ZK4 1.9 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
2XYS 1.91 Å, Crystal structure of Aplysia californica AChBP in complex with strychnine
5TVC 1.93 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
3C84 1.94 Å, Crystal structure of a complex of AChBP from aplysia californica and the neonicotinoid…
2YMD 1.96 Å, Crystal structure of a mutant binding protein (5HTBP-AChBP) in complex with serotonin…
4WV9 2.0 Å, Crystal structure of acetylcholine binding protein (AChBP) from Aplysia Californica in…

Browse structure collections

About this viewer

MolViewer shows 4XHE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.