2YBA: Nurf55

Crystal structure of Nurf55 in complex with histone H3. Determined by X-ray diffraction at 2.55 Å resolution. Released 11 May 2011.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: DROSOPHILA MELANOGASTER
Chains: 4
Atoms: 6,457
Mol. weight: 99.68 kDa
Released: 11 May 2011

Explore 2YBA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YBA contains 17 α-helices and 60 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	12-35	24
β-strand	36-43	8	1
β-strand	52-59	8	2
β-strand	65-73	9	2
α-helix	80	1
β-strand	81-91	11	2
β-strand	119-127	9	2
β-strand	133-137	5	3
β-strand	140-147	8	3
β-strand	153-157	5	3
α-helix	158-160	3
α-helix	165-166	2
β-strand	175-178	4	3
β-strand	187-189	3	4
β-strand	196-200	5	4
β-strand	206-210	5	4
α-helix	214-215	2
β-strand	216	1	3
β-strand	220-222	3	3
β-strand	225-227	3	4
β-strand	234-239	6	5
β-strand	246-251	6	5
β-strand	255-260	6	5
β-strand	271-274	4	5
β-strand	280-285	6	6
β-strand	292-297	6	6
β-strand	301-306	6	6
β-strand	315-318	4	6
β-strand	324-329	6	7
β-strand	336-341	6	7
β-strand	346-350	5	7
α-helix	351-353	3
α-helix	360-363	4
β-strand	370-374	5	7
β-strand	381-386	6	1
β-strand	393-398	6	1
β-strand	402-408	7	1
α-helix	410-413	4

Chain B: 7 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	12-35	24
β-strand	36-43	8	8
β-strand	52-59	8	9
β-strand	65-73	9	9
β-strand	81-91	11	9
β-strand	119-127	9	9
β-strand	133-137	5	10
β-strand	140-147	8	10
β-strand	153-157	5	10
α-helix	158-160	3
α-helix	165-166	2
β-strand	175-178	4	10
β-strand	187-189	3	11
β-strand	196-200	5	11
β-strand	206-210	5	11
α-helix	214-215	2
β-strand	216	1	10
β-strand	220-222	3	10
β-strand	225-227	3	11
β-strand	234-239	6	12
β-strand	246-251	6	12
β-strand	255-260	6	12
β-strand	271-274	4	12
β-strand	280-285	6	13
β-strand	292-297	6	13
β-strand	301-306	6	13
β-strand	315-318	4	13
β-strand	324-329	6	14
β-strand	336-341	6	14
β-strand	346-350	5	14
α-helix	351-353	3
α-helix	360-363	4
β-strand	370-374	5	14
β-strand	381-386	6	8
β-strand	393-398	6	8
β-strand	402-408	7	8
α-helix	410-413	4

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable histone-binding protein CAF1	A, B	protein	422	DROSOPHILA MELANOGASTER	Q24572 (AlphaFold model)
Histone H3	C, D	protein	19	DROSOPHILA MELANOGASTER	P02299 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2YBA_1 PROBABLE HISTONE-BINDING PROTEIN CAF1 (chains A, B)
GGGRMVDRSDNAAESFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPD
VTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVC
GKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLR
LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED
VAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATG
SADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGE
EQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDE
EP

Sequence of entity 2 (C, D), FASTA

>2YBA_2 HISTONE H3 (chains C, D)
ARTKQTARKSTGGKAPRKQ

Primary citation

Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks. Schmitges, F.W., Prusty, A.B., Faty, M. et al. Mol Cell (2011) 42:330. DOI 10.1016/J.MOLCEL.2011.03.025 · PubMed

Other PDB entries of the same protein (UniProt Q24572 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XYI 1.75 Å, Crystal Structure of Nurf55 in complex with a H4 peptide
2YB8 2.3 Å, Crystal structure of Nurf55 in complex with Su(z)12
3C99 2.9 Å, Structural Basis of Histone H4 Recognition by p55
3C9C 3.2 Å, Structural Basis of Histone H4 Recognition by p55

Browse structure collections

About this viewer

MolViewer shows 2YBA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.