2YBF: Ubiquitin-conjugating enzyme E2 B

Name: PDB 2YBF: Complex of Rad18 (Rad6 binding domain) with Rad6b
Published: 2011-04-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Complex of Rad18 (Rad6 binding domain) with Rad6b. Determined by X-ray diffraction at 2.0 Å resolution. Released 20 Apr 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,532
Mol. weight: 20.84 kDa
Released: 20 Apr 2011

Explore 2YBF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YBF contains 10 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-18	15
α-helix	20-21	2
β-strand	24-29	6	1
β-strand	32-41	10	1
α-helix	42-43	2
β-strand	52-58	7	1
α-helix	67-68	2
β-strand	69-72	4	1
β-strand	81	1	2
β-strand	86	1	1
β-strand	87	1	2
α-helix	90-92	3
α-helix	102-114	13
α-helix	124-131	8
α-helix	134-147	14

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	342-345	4
α-helix	347-358	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-conjugating enzyme E2 B	A	protein	152	HOMO SAPIENS	P63146 (AlphaFold model)
E3 ubiquitin-protein ligase RAD18	B	protein	27	HOMO SAPIENS	Q9NS91 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YBF_1 UBIQUITIN-CONJUGATING ENZYME E2 B (chains A)
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS
EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWNDS

Sequence of entity 2 (B), FASTA

>2YBF_2 E3 UBIQUITIN-PROTEIN LIGASE RAD18 (chains B)
SKYRKKHKSEFQLLVDQARKGYKKIAG

Primary citation

E3 Ligase Rad18 Promotes Monoubiquitination Rather Than Ubiquitin Chain Formation by E2 Enzyme Rad6. Hibbert, R.G., Huang, A., Boelens, R. et al. Proc Natl Acad Sci U S A (2011) 108:5590. DOI 10.1073/PNAS.1017516108 · PubMed

Other PDB entries of the same protein (UniProt P63146 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2YB6 1.5 Å, Native human Rad6
1JAS HsUbc2b
2Y4W Solution structure of human ubiquitin conjugating enzyme Rad6b

Browse structure collections

About this viewer

MolViewer shows 2YBF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.