2YFV: Histone H3-like centromeric protein CSE4

The heterotrimeric complex of Kluyveromyces lactis Scm3, Cse4 and H4. Determined by X-ray diffraction at 2.32 Å resolution. Released 25 May 2011.

Method: X-ray diffraction
Resolution: 2.32 Å
Organism: KLUYVEROMYCES LACTIS NRRL Y-1140
Chains: 3
Atoms: 1,696
Mol. weight: 27.83 kDa
Released: 25 May 2011

Explore 2YFV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YFV contains 8 α-helices and 8 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	110-122	13
β-strand	132-133	2	1
α-helix	135-162	28
β-strand	167-168	2	2
α-helix	170-178	9

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	31-40	10
β-strand	45-46	2	2
α-helix	49-75	27
β-strand	80-81	2	1
α-helix	83-96	14

Chain C: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	46-48	3	3
β-strand	54-56	3	3
α-helix	60-86	27
α-helix	88-90	3
β-strand	95	1	4
β-strand	102	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H3-like centromeric protein CSE4	A	protein	100	KLUYVEROMYCES LACTIS NRRL Y-1140	Q6CTI2 (AlphaFold model)
Histone H4	B	protein	74	KLUYVEROMYCES LACTIS NRRL Y-1140	Q6CMU6 (AlphaFold model)
SCM3	C	protein	63	KLUYVEROMYCES LACTIS NRRL Y-1140	Q6CL77 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YFV_1 HISTONE H3-LIKE CENTROMERIC PROTEIN CSE4 (chains A)
KARGTRYKPTDLALAEIRKYQRSTDLLISRMPFARLVKEVTDQFTTESEPLRWQSMAIMA
LQEASEAYLVGLLEHTNLLALHAKRITIMRKDMQLARRIR

Sequence of entity 2 (B), FASTA

>2YFV_2 HISTONE H4 (chains B)
DNIQGITKPAIRRLARRGGVKRISGLIYEEVRNVLKTFLESVIRDAVTYTEHAKRKTVTS
LDVVYALKRQGRTL

Sequence of entity 3 (C), FASTA

>2YFV_3 SCM3 (chains C)
RDGVVYIMSKENRLIPKLSDEEVMERHKKADENMKRVWSQIIQKYESIDNQGDVIDLQTG
EVI

Primary citation

Recognition of the Centromere-Specific Histone Cse4 by the Chaperone Scm3. Cho, U.S., Harrison, S.C. Proc Natl Acad Sci U S A (2011) 108:9367. DOI 10.1073/PNAS.1106389108 · PubMed

Other PDB entries of the same protein (UniProt Q6CTI2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2YFW 2.6 Å, Heterotetramer structure of Kluyveromyces lactis Cse4,H4

Browse structure collections

About this viewer

MolViewer shows 2YFV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.