2YH9: Dimeric BamE from E. coli

Name: PDB 2YH9: Crystal structure of the dimeric BamE from E. coli
Published: 2011-06-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Crystal structure of the dimeric BamE from E. coli. Determined by X-ray diffraction at 1.8 Å resolution. Released 29 Jun 2011.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: ESCHERICHIA COLI
Chains: 3
Atoms: 1,749
Mol. weight: 29.72 kDa
Released: 29 Jun 2011

Explore 2YH9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YH9 contains 3 α-helices and 15 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
α-helix	14-21	8
β-strand	26-27	2	2
β-strand	34-38	5	3
β-strand	52-57	6	3
β-strand	62	1	4
β-strand	63-69	7	3

Chain B: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
α-helix	14-21	8
β-strand	34-38	5	5
β-strand	52-57	6	5
β-strand	63-69	7	5

Chain C: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	4
α-helix	14-21	8
β-strand	26-27	2	3
β-strand	34-38	5	2
β-strand	52-57	6	2
β-strand	62	1	1
β-strand	63-67	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small protein A	A, B, C	protein	88	ESCHERICHIA COLI	P0A937 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2YH9_1 SMALL PROTEIN A (chains A, B, C)
QGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTL
TFNSSGVLTNIDNKPALSGNLEHHHHHH

Primary citation

Structural Basis of Outer Membrane Protein Biogenesis in Bacteria. Albrecht, R., Zeth, K. J Biol Chem (2011) 286:27792. DOI 10.1074/JBC.M111.238931 · PubMed

Other PDB entries of the same protein (UniProt P0A937 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CNW 2.6 Å, CryoEM structure of the APO-BAM complex in DDM detergent
9HG6 2.73 Å, BAM-SurA complex in the swing-in state
9HG5 2.82 Å, BAM-SurA complex in the swing-in state with full length BamC resolved
9HG7 2.83 Å, BAM-SurA complex in the swing-out state
9HG9 2.88 Å, BAM-SurA-darobactin complex in the swing-in state
5D0O 2.9 Å, BamABCDE complex, outer membrane beta barrel assembly machinery entire complex
8PZV 2.9 Å, Wait Complex: BAM bound Darobactin-B and Extended SurA
9HG8 2.9 Å, BAM-SurA complex in the swing-out state with BamC resolved
8ADG 3.0 Å, Cryo-EM structure of Darobactin 22 bound BAM complex
9HE1 3.0 Å, Structure of the Xenorceptide A2-bound E. coli BAM complex (BamABCDE)
7NRI 3.03 Å, Structure of the darobactin-bound E. coli BAM complex (BamABCDE)
6LYS 3.05 Å, Structure of the BAM complex

Browse structure collections

About this viewer

MolViewer shows 2YH9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.