2YHC: BamD from E. coli

Name: PDB 2YHC: Structure of BamD from E. coli
Published: 2011-06-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Structure of BamD from E. coli. Determined by X-ray diffraction at 1.8 Å resolution. Released 1 Jun 2011.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: ESCHERICHIA COLI
Chains: 1
Atoms: 1,813
Mol. weight: 26.02 kDa
Ligands: URE
Released: 1 Jun 2011

Explore 2YHC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YHC contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	12-25	14
α-helix	28-41	14
α-helix	48-61	14
α-helix	65-78	14
α-helix	85-100	16
α-helix	118-131	14
α-helix	140-168	29
α-helix	171-184	14
α-helix	189-204	16
α-helix	208-220	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
UPF0169 lipoprotein yfio	A	protein	225	ESCHERICHIA COLI	P0AC02 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YHC_1 UPF0169 LIPOPROTEIN YFIO (chains A)
DNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLA
QAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQQARAAFSDFS
KLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDT
QATRDALPLMENAYRQMQMNAQAEKVAKIIAANSSNTLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
URE	Urea	C H4 N2 O	1

Primary citation

Structural Basis of Outer Membrane Protein Biogenesis in Bacteria. Albrecht, R., Zeth, K. J Biol Chem (2011) 286:27792. DOI 10.1074/JBC.M111.238931 · PubMed

Other PDB entries of the same protein (UniProt P0AC02 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CNW 2.6 Å, CryoEM structure of the APO-BAM complex in DDM detergent
3Q5M 2.6 Å, Crystal structure of Escherichia coli BamD
9HG6 2.73 Å, BAM-SurA complex in the swing-in state
9HG5 2.82 Å, BAM-SurA complex in the swing-in state with full length BamC resolved
9HG7 2.83 Å, BAM-SurA complex in the swing-out state
9HG9 2.88 Å, BAM-SurA-darobactin complex in the swing-in state
3TGO 2.9 Å, Crystal structure of the E. coli BamCD complex
5D0O 2.9 Å, BamABCDE complex, outer membrane beta barrel assembly machinery entire complex
8PZV 2.9 Å, Wait Complex: BAM bound Darobactin-B and Extended SurA
9HG8 2.9 Å, BAM-SurA complex in the swing-out state with BamC resolved
8ADG 3.0 Å, Cryo-EM structure of Darobactin 22 bound BAM complex
9HE1 3.0 Å, Structure of the Xenorceptide A2-bound E. coli BAM complex (BamABCDE)

Browse structure collections

About this viewer

MolViewer shows 2YHC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.