2YI7: Heat shock protein hsp 90-alpha

Structural characterization of 5-Aryl-4-(5-substituted-2-4- dihydroxyphenyl)-1,2,3-thiadiazole Hsp90 inhibitors. Determined by X-ray diffraction at 1.4 Å resolution. Released 16 May 2012.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,048
Mol. weight: 26.23 kDa
Ligands: BZ8, MG
Released: 16 May 2012

Explore 2YI7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YI7 contains 11 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	1
α-helix	22-23	2
α-helix	24-35	12
α-helix	43-65	23
α-helix	67-70	4
β-strand	78-83	6	1
β-strand	88-93	6	1
α-helix	100-104	5
α-helix	106-108	3
α-helix	111-123	13
α-helix	128-134	7
α-helix	137-143	7
β-strand	145-153	9	1
β-strand	159-164	6	1
β-strand	169-174	6	1
β-strand	183-190	8	1
α-helix	192-198	7
α-helix	200-210	11
β-strand	218-220	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein hsp 90-alpha	A	protein	229	HOMO SAPIENS	P07900 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YI7_1 HEAT SHOCK PROTEIN HSP 90-ALPHA (chains A)
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKE

Ligands and cofactors

ID	Name	Formula	Copies
BZ8	4-chloro-6-[5-(4-ethoxyphenyl)-1,2,3-thiadiazol-4-yl benzene-1,3-diol	C16 H13 Cl N2 O3 S	1
MG	Magnesium ion	Mg	1

Primary citation

Co-Crystalization and in Vitro Biological Characterization of 5-Aryl-4-(5-Substituted-2-4-Dihydroxyphenyl)-1,2,3-Thiadiazole Hsp90 Inhibitors. Sharp, S.Y., Roe, S.M., Kazlauskas, E. et al. PLoS One (2012) 7:44642. DOI 10.1371/JOURNAL.PONE.0044642 · PubMed

Other PDB entries of the same protein (UniProt P07900 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TN5 1.17 Å, Rapid optimisation of fragments and hits to lead compounds from screening of crude…
5J80 1.17 Å, Crystal Structure of Apo Hsp90-alpha N-domain L107A mutant
3T0H 1.2 Å, Structure insights into mechanisms of ATP hydrolysis and the activation of human Hsp90
5J2X 1.22 Å, Crystal Structure of Hsp90-alpha N-domain in complex with…
3T10 1.24 Å, HSP90 N-terminal domain bound to ACP
6TN4 1.27 Å, Rapid optimisation of fragments and hits to lead compounds from screening of crude…
3WHA 1.3 Å, Hsp90 alpha N-terminal domain in complex with a tricyclic inhibitor
5XRD 1.3 Å, Crystal Structure of the human Hsp90-alpha N-domain bound to the hsp90 inhibitor FS7
2YK9 1.32 Å, Tricyclic series of Hsp90 inhibitors
5LRL 1.33 Å, Crystal structure of HSP90 in complex with A003492875
6GR5 1.34 Å, Structure of human Heat shock protein 90-alpha N-terminal domain (Hsp90-NTD) variant…
3B28 1.35 Å, Hsp90 alpha N-terminal domain in complex with an inhibitor CH5015765

Browse structure collections

About this viewer

MolViewer shows 2YI7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.