tau55 histidine phosphatase domain. Determined by X-ray diffraction at 1.5 Å resolution. Released 3 Apr 2013.
Explore 2YN0 in 3D Show helices and sheets RCSB PDB PDBe
2YN0 contains 15 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| β-strand | 14 | 1 | 2 |
| α-helix | 15-17 | 3 | |
| α-helix | 22-26 | 5 | |
| α-helix | 34-35 | 2 | |
| β-strand | 36 | 1 | 2 |
| α-helix | 37 | 1 | |
| α-helix | 38-52 | 15 | |
| β-strand | 61-63 | 3 | 1 |
| α-helix | 67-80 | 14 | |
| β-strand | 84-86 | 3 | 1 |
| α-helix | 88-90 | 3 | |
| α-helix | 91-93 | 3 | |
| α-helix | 108-114 | 7 | |
| β-strand | 119 | 1 | 1 |
| α-helix | 123-125 | 3 | |
| α-helix | 136-157 | 22 | |
| β-strand | 163-168 | 6 | 1 |
| α-helix | 170-181 | 12 | |
| β-strand | 204-209 | 6 | 1 |
| α-helix | 210-211 | 2 | |
| α-helix | 231-233 | 3 | |
| β-strand | 236-243 | 8 | 1 |
| α-helix | 257-259 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcription factor tau 55 kda subunit | A | protein | 271 | SACCHAROMYCES CEREVISIAE | Q12415 (AlphaFold model) |
>2YN0_1 TRANSCRIPTION FACTOR TAU 55 KDA SUBUNIT (chains A) MVNTIYIARHGYRSNWLPEGPYPDPLTGIDSDVPLAEHGVQQAKELAHYLLSLDNQPEAA FASPFYRCLETVQPIAKLLEIPVYLERGIGEWYRPDRKPVIPVPAGYEILSKFFPGVISQ EWDSTLTPNEKGETEQEMYMRFKKFWPLFIERVEKEYPNVECILLVTHAASKIALGMSLL GYDNPRMSLNENGDKIRSGSCSLDKYEILKKSYDTIDETDDQTSFTYIPFSDRKWVLTMN GNTEFLSSGEEMNWNFDCVAEAGSDADIKKR
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
Structural and Functional Characterization of a Phosphatase Domain within Yeast General Transcription Factor Iiic. Taylor, N.M.I., Glatt, S., Hennrich, M.L. et al. J Biol Chem (2013) 288:15110. DOI 10.1074/JBC.M112.427856 · PubMed
Other PDB entries of the same protein (UniProt Q12415 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2YN0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.