2YNN: Yeast betaprime COP 1-304 with KTKTN motif

yeast betaprime COP 1-304 with KTKTN motif. Determined by X-ray diffraction at 1.78 Å resolution. Released 12 Dec 2012.

Method: X-ray diffraction
Resolution: 1.78 Å
Organisms: SACCHAROMYCES CEREVISIAE, SYNTHETIC CONSTRUCT
Chains: 2
Atoms: 2,776
Mol. weight: 35.88 kDa
Released: 12 Dec 2012

Explore 2YNN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YNN contains 4 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
α-helix	15	1
β-strand	16-21	6	2
β-strand	27-32	6	2
β-strand	36-41	6	2
β-strand	46-52	7	2
β-strand	58-64	7	3
α-helix	65-67	3
β-strand	69-74	6	3
β-strand	78-83	6	3
β-strand	89-94	6	3
β-strand	100-105	6	4
β-strand	111-116	6	4
β-strand	121-125	5	4
α-helix	126-128	3
β-strand	131-136	6	4
β-strand	143-148	6	5
β-strand	155-160	6	5
β-strand	164-169	6	5
β-strand	177-180	4	5
β-strand	187-192	6	6
β-strand	200-205	6	6
β-strand	209-214	6	6
β-strand	219-225	7	6
β-strand	231-236	6	7
β-strand	242-247	6	7
β-strand	252-256	5	7
β-strand	262-266	5	7
β-strand	273-278	6	1
α-helix	283-285	3
β-strand	287-291	5	1
β-strand	294-299	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coatomer subunit beta'	A	protein	304	SACCHAROMYCES CEREVISIAE	P41811 (AlphaFold model)
Ktktn motif	P	protein	8	SYNTHETIC CONSTRUCT

Sequence of entity 1 (A), FASTA

>2YNN_1 COATOMER SUBUNIT BETA' (chains A)
MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRA
GKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLT
VKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLT
TGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTL
PIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSL
GNDE

Sequence of entity 2 (P), FASTA

>2YNN_2 KTKTN MOTIF (chains P)
CTFKTKTN

Primary citation

Molecular Basis for Recognition of Dilysine Trafficking Motifs by Copi. Jackson, L.P., Lewis, M., Kent, H.M. et al. Dev Cell (2012) 23:1255. DOI 10.1016/J.DEVCEL.2012.10.017 · PubMed

Other PDB entries of the same protein (UniProt P41811 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8EWX 1.24 Å, N-terminal WD40 domain of beta'-COPI subunit with two chains in the asymmetric unit
8F0E 1.31 Å, N-terminal WD40 domain of beta'-COPI subunit with four chains in the asymmetric unit
8HQV 1.4 Å, The complex structure of COPI cargo sorting module with HCoV-OC43 Spike KTSHxx sorting…
8HQW 1.41 Å, The complex structure of COPI cargo sorting module with MHV Spike Hxx sorting motif
4J73 1.44 Å, Crystal structure of beta'-COP/p25 complex
8ENS 1.45 Å, Crystal structure of beta'-COPI-WD40 domain in complex with SARS-CoV-2 spike tail…
8ENW 1.45 Å, Crystal structure of beta'-COPI-WD40 domain in complex with SARS-CoV-2 clientized spike…
4J82 1.46 Å, Crystal structure of beta'-COP/Insig-2 complex
4J84 1.47 Å, Crystal structure of beta'-COP/Scyl1 complex
4J78 1.48 Å, Crystal structure of beta'-COP/Emp47p complex
4J86 1.48 Å, Crystal structure of beta'-COP/yWbp1 complex
8HQX 1.54 Å, The complex structure of COPI cargo sorting module with TAT-WDM peptide

Browse structure collections

About this viewer

MolViewer shows 2YNN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.