2YPS: PX domain of human sorting nexin 3

Crystal structure of the PX domain of human sorting nexin 3. Determined by X-ray diffraction at 2.6 Å resolution. Released 20 Mar 2013.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 3,102
Mol. weight: 62.61 kDa
Released: 20 Mar 2013

Explore 2YPS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YPS contains 24 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	29-34	6	1
α-helix	44-46	3
β-strand	49-55	7	1
β-strand	64-69	6	1
α-helix	71-84	14
α-helix	87-91	5
α-helix	114-131	18
α-helix	133-136	4
α-helix	139-146	8

Chain B: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	29-34	6	2
α-helix	44-46	3
β-strand	48-55	8	2
β-strand	64-70	7	2
α-helix	71-84	14
α-helix	87-91	5
α-helix	113-131	19
α-helix	133-136	4
α-helix	139-146	8

Chains C and D: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	29-34	6	3
α-helix	44-46	3
β-strand	48-55	8	3
β-strand	64-70	7	3
α-helix	71-84	14
α-helix	87-91	5
α-helix	115-131	17
α-helix	133-136	4
α-helix	139-146	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-3	A, B, C, D	protein	134	HOMO SAPIENS	O60493 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2YPS_1 SORTING NEXIN-3 (chains A, B, C, D)
SMPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSEL
ERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCL
HMFLQDEIIDKSYT

Primary citation

Crystal Structure of the Px Domain of Human Sorting Nexin 3. Canning, P., Froese, D.S., Krojer, T. et al. To be published.

Other PDB entries of the same protein (UniProt O60493 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5F0J 2.7 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3
5F0P 2.78 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1(L557M) (SeMet labeled)
5F0M 3.1 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1 (SeMet labeled)
5F0L 3.2 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1
7BLO 9.5 Å, VPS26 dimer region of metazoan membrane-assembled retromer:SNX3 complex modelled with…
2MXC Solution structure of the full length sorting nexin 3

Browse structure collections

About this viewer

MolViewer shows 2YPS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.