2YT0: PDB entry 2YT0

Solution structure of the chimera of the C-terminal tail peptide of APP and the C-terminal PID domain of Fe65L. Determined by solution NMR. Released 8 Apr 2008.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 1,337
Mol. weight: 19.17 kDa
Released: 8 Apr 2008

Explore 2YT0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YT0 contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	13-23	11
β-strand	26-27	2	1
α-helix	30-33	4
β-strand	63-73	11	1
α-helix	80-93	14
α-helix	100	1
β-strand	101-105	5	1
α-helix	107-109	3
β-strand	110-115	6	1
β-strand	122-127	6	1
β-strand	133-136	4	1
β-strand	142-150	9	1
β-strand	153-161	9	1
α-helix	166-175	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amyloid beta A4 protein and Amyloid beta A4 precursor protein-binding family B member 2	A	protein	176	Mus musculus	Q9DBR4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YT0_1 Amyloid beta A4 protein and Amyloid beta A4 precursor protein-binding family B member 2 (chains A)
GSSGSSGDAAVTPEERHLSKMQQNGYENPTYKFFEQMQNSGSSGSSGSSGSSGPTPKTEL
VQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEE
EVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAAC

Primary citation

Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode. Li, H., Koshiba, S., Hayashi, F. et al. J Biol Chem (2008) 283:27165-27178. DOI 10.1074/jbc.M803892200 · PubMed

Other PDB entries of the same protein (UniProt Q9DBR4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WGU Solution Structure of the C-terminal Phosphotyrosine Interaction Domain of APBB2 from…
2ROZ Structure of the C-terminal PID Domain of Fe65L1 Complexed with the Cytoplasmic Tail of…
2YSZ Solution structure of the chimera of the C-terminal PID domain of Fe65L and the…
2YT1 Solution structure of the chimera of the C-terminal tail peptide of APP and the…

Browse structure collections

About this viewer

MolViewer shows 2YT0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.