2Z31: Immune receptor complex

Crystal structure of immune receptor complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 9 Oct 2007.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Mus musculus
Chains: 5
Atoms: 4,841
Mol. weight: 68.63 kDa
Released: 9 Oct 2007

Explore 2Z31 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Z31 contains 13 α-helices and 54 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	9-13	5	2
α-helix	16-17	2
β-strand	18-20	3	3
β-strand	22-25	4	1
β-strand	31-37	7	2
β-strand	44-49	6	2
β-strand	55-58	4	3
β-strand	62-65	4	3
β-strand	67	1	1
β-strand	72	1	1
β-strand	75-77	3	3
α-helix	82-84	3
β-strand	86-93	8	2
β-strand	104-106	3	2
β-strand	110-115	6	2

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	4
β-strand	10-13	4	2
β-strand	19-25	7	4
β-strand	31-38	8	2
β-strand	42-49	8	2
β-strand	56-57	2	2
β-strand	67-68	2	4
β-strand	74-79	6	4
α-helix	84-86	3
β-strand	88-95	8	2
β-strand	107-108	2	2
β-strand	112-116	5	2

Chain C: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	11	5
β-strand	19-26	8	5
β-strand	29-35	7	5
β-strand	40-43	4	5
α-helix	46-49	4
α-helix	56-76	21
α-helix	81-84	4
β-strand	88-93	6	6
β-strand	103-112	10	6
β-strand	118-123	6	7
β-strand	126-128	3	7
β-strand	132-134	3	6
α-helix	137	1
β-strand	138-139	2	6
β-strand	145-153	9	6
β-strand	161-166	6	7
β-strand	174	1	7
β-strand	178	1	7

Chain D: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	9-17	9	5
β-strand	24-32	9	5
β-strand	35-41	7	5
β-strand	47-49	3	5
α-helix	57-74	16
α-helix	75-80	6
α-helix	81-82	2
α-helix	83-86	5
α-helix	90-92	3
β-strand	95	1	8
α-helix	96-97	2
β-strand	98-103	6	9
β-strand	113-122	10	9
β-strand	123	1	8
β-strand	128-133	6	10
β-strand	137-138	2	10
β-strand	142-144	3	9
β-strand	148-149	2	9
β-strand	155-163	9	9
β-strand	170-176	7	10
β-strand	184-189	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-cell receptor alpha-chain	A	protein	112	Mus musculus	Q5R1F5 (AlphaFold model)
T-cell receptor beta-chain	B	protein	111	Mus musculus	A2NTY6 (AlphaFold model)
H-2 class II histocompatibility antigen, A-U alpha chain	C	protein	181	Mus musculus	P14438 (AlphaFold model)
H-2 class II histocompatibility antigen, A-U beta chain precursor	D	protein	189	Mus musculus	P06344 (AlphaFold model)
Myelin basic protein (MBP)-peptide	P	protein	11

Sequence of entity 1 (A), FASTA

>2Z31_1 T-cell receptor alpha-chain (chains A)
DSVTQTGGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRG
FEATYNKEATSFHLQKASVQESDSAVYYCALSENYGNEKITFGAGTKLQVVP

Sequence of entity 2 (B), FASTA

>2Z31_2 T-cell receptor beta-chain (chains B)
AVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHGLRLIYYSYGAGSTEKGDIPD
GYKASRPSQENFSLTLESATPSQTSVYFCASGDASGGNTLYFGAGTRLSVL

Sequence of entity 3 (C), FASTA

>2Z31_3 H-2 class II histocompatibility antigen, A-U alpha chain (chains C)
IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGG
LQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINI
TWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWE
P

Sequence of entity 4 (D), FASTA

>2Z31_4 H-2 class II histocompatibility antigen, A-U beta chain precursor (chains D)
GDSERHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEY
YNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTD
FYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLK
SPITVEWRA

Sequence of entity 5 (P), FASTA

>2Z31_5 Myelin basic protein (MBP)-peptide (chains P)
RGGASQYRPSQ

Primary citation

Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'. Feng, D., Bond, C.J., Ely, L.K. et al. Nat Immunol (2007) 8:975-983. DOI 10.1038/ni1502 · PubMed

Other PDB entries of the same protein (UniProt Q5R1F5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z35 2.2 Å, Crystal structure of immune receptor
2PXY 2.23 Å, Crystal structures of immune receptor complexes

Browse structure collections

About this viewer

MolViewer shows 2Z31 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.