Crystal structure of the TLR1-TLR2 heterodimer induced by binding of a tri-acylated lipopeptide. Determined by X-ray diffraction at 2.6 Å resolution. Released 2 Oct 2007.
Explore 2Z82 in 3D Show helices and sheets RCSB PDB PDBe
2Z82 contains 16 α-helices and 35 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 29-30 | 2 | 1 |
| β-strand | 35-37 | 3 | 1 |
| α-helix | 46-47 | 2 | |
| β-strand | 56-58 | 3 | 1 |
| β-strand | 66-67 | 2 | 2 |
| β-strand | 80-82 | 3 | 1 |
| β-strand | 90-91 | 2 | 2 |
| β-strand | 104-106 | 3 | 1 |
| α-helix | 117-120 | 4 | |
| β-strand | 128-130 | 3 | 1 |
| β-strand | 153-158 | 6 | 1 |
| β-strand | 164-165 | 2 | 3 |
| β-strand | 175-183 | 9 | 1 |
| β-strand | 188-189 | 2 | 3 |
| β-strand | 199-207 | 9 | 1 |
| α-helix | 213-220 | 8 | |
| β-strand | 226-230 | 5 | 1 |
| β-strand | 233 | 1 | 4 |
| β-strand | 253-257 | 5 | 1 |
| β-strand | 260-262 | 3 | 4 |
| α-helix | 263-271 | 9 | |
| α-helix | 272-275 | 4 | |
| β-strand | 281-285 | 5 | 1 |
| β-strand | 288-290 | 3 | 4 |
| β-strand | 311-315 | 5 | 1 |
| β-strand | 318 | 1 | 4 |
| α-helix | 322-324 | 3 | |
| β-strand | 340-344 | 5 | 1 |
| α-helix | 353-358 | 6 | |
| β-strand | 364-366 | 3 | 1 |
| α-helix | 374-380 | 7 | |
| β-strand | 391-393 | 3 | 1 |
| α-helix | 402-408 | 7 | |
| α-helix | 409-411 | 3 | |
| β-strand | 417-419 | 3 | 1 |
| α-helix | 425-428 | 4 | |
| β-strand | 440-442 | 3 | 1 |
| β-strand | 461-463 | 3 | 1 |
| β-strand | 481-483 | 3 | 1 |
| α-helix | 492-494 | 3 | |
| α-helix | 495-497 | 3 | |
| β-strand | 503-505 | 3 | 1 |
| α-helix | 519-521 | 3 | |
| β-strand | 527-529 | 3 | 1 |
| β-strand | 535 | 1 | 5 |
| α-helix | 543-551 | 9 | |
| β-strand | 556-557 | 2 | 1 |
| β-strand | 561 | 1 | 6 |
| β-strand | 562 | 1 | 5 |
| β-strand | 568 | 1 | 6 |
| α-helix | 569-571 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Toll-like receptor 2, Variable lymphocyte receptor B | A | protein | 549 | Mus musculus, Eptatretus burgeri | Q9QUN7 (AlphaFold model) |
>2Z82_1 Toll-like receptor 2, Variable lymphocyte receptor B (chains A) SLSCDASGVCDGRSRSFTSIPSGLTAAMKSLDLSFNKITYIGHGDLRACANLQVLILKSS RINTIEGDAFYSLGSLEHLDLSDNHLSSLSSSWFGPLSSLKYLNLMGNPYQTLGVTSLFP NLTNLQTLRIGNVETFSEIRRIDFAGLTSLNELEIKALSLRNYQSQSLKSIRDIHHLTLH LSESAFLLEIFADILSSVRYLELRDTNLARFQFSPLPVDEVSSPMKKLAFRGSVLTDESF NELLKLLRYILELSEVEFDDCTLNGLGDFNPSESDVVSELGKVETVTIRRLHIPQFYLFY DLSTVYSLLEKVKRITVENSKVFLVPCSFSQHLKSLEFLDLSENLMVEEYLKNSACKGAW PSLQTLVLSQNHLRSMQKTGEILLTLKNLTSLDISRNTFHPMPDSCQWPEKMRFLNLSST GIRVVKTCIPQTLEVLDVSNNNLDSFSLFLPRLQELYISRNKLKTLPDASLFPVLLVMKI SRNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSG KPVRSIICP
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
| PDJ | (2R)-3-{[(2R)-2-amino-3-hydroxypropyl]thio}propane-1,2-diyl dihexadecanoate | C38 H75 N O5 S | 1 |
Crystal Structure of the TLR1-TLR2 Heterodimer Induced by Binding of a Tri-Acylated Lipopeptide. Jin, M.S., Kim, S.E., Heo, J.Y. et al. Cell (2007) 130:1071-1082. DOI 10.1016/j.cell.2007.09.008 · PubMed
Other PDB entries of the same protein (UniProt Q9QUN7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2Z82 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.