Crystal structure of TLR2-Streptococcus Pneumoniae lipoteichoic acid complex. Determined by X-ray diffraction at 2.53 Å resolution. Released 24 Nov 2009.
Explore 3A7B in 3D Show helices and sheets RCSB PDB PDBe
3A7B contains 15 α-helices and 35 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 29-30 | 2 | 1 |
| β-strand | 35-37 | 3 | 1 |
| β-strand | 56-58 | 3 | 1 |
| β-strand | 66-67 | 2 | 2 |
| β-strand | 80-82 | 3 | 1 |
| β-strand | 90-91 | 2 | 2 |
| β-strand | 104-106 | 3 | 1 |
| α-helix | 117-120 | 4 | |
| β-strand | 128-130 | 3 | 1 |
| β-strand | 153-158 | 6 | 1 |
| β-strand | 164-165 | 2 | 3 |
| β-strand | 175-183 | 9 | 1 |
| β-strand | 188-189 | 2 | 3 |
| α-helix | 194-196 | 3 | |
| β-strand | 199-206 | 8 | 1 |
| α-helix | 213-220 | 8 | |
| β-strand | 224-230 | 7 | 1 |
| β-strand | 233 | 1 | 4 |
| β-strand | 253-256 | 4 | 1 |
| β-strand | 260-261 | 2 | 4 |
| α-helix | 263-270 | 8 | |
| α-helix | 271-275 | 5 | |
| β-strand | 281-284 | 4 | 1 |
| β-strand | 288-289 | 2 | 4 |
| β-strand | 311-315 | 5 | 1 |
| β-strand | 318 | 1 | 4 |
| α-helix | 329-335 | 7 | |
| β-strand | 340-344 | 5 | 1 |
| α-helix | 353-358 | 6 | |
| β-strand | 364-366 | 3 | 1 |
| α-helix | 374-380 | 7 | |
| β-strand | 391-393 | 3 | 1 |
| α-helix | 402-409 | 8 | |
| β-strand | 417-419 | 3 | 1 |
| α-helix | 425-428 | 4 | |
| β-strand | 440-442 | 3 | 1 |
| β-strand | 461-463 | 3 | 1 |
| β-strand | 481-483 | 3 | 1 |
| α-helix | 492-494 | 3 | |
| α-helix | 495-497 | 3 | |
| β-strand | 503-505 | 3 | 1 |
| α-helix | 518-521 | 4 | |
| β-strand | 527-529 | 3 | 1 |
| β-strand | 535 | 1 | 5 |
| α-helix | 543-550 | 8 | |
| β-strand | 556-557 | 2 | 1 |
| α-helix | 560 | 1 | |
| β-strand | 561 | 1 | 6 |
| β-strand | 562 | 1 | 5 |
| β-strand | 568 | 1 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Toll-like receptor 2, Variable lymphocyte receptor B | A | protein | 580 | Mus musculus, Eptatretus burgeri | Q4G1L2 (AlphaFold model), Q9QUN7 (AlphaFold model) |
>3A7B_1 Toll-like receptor 2, Variable lymphocyte receptor B (chains A) MLRALWLFWILVAITVLFSKRCSAQESLSCDASGVCDGRSRSFTSIPSGLTAAMKSLDLS FNKITYIGHGDLRACANLQVLILKSSRINTIEGDAFYSLGSLEHLDLSDNHLSSLSSSWF GPLSSLKYLNLMGNPYQTLGVTSLFPNLTNLQTLRIGNVETFSEIRRIDFAGLTSLNELE IKALSLRNYQSQSLKSIRDIHHLTLHLSESAFLLEIFADILSSVRYLELRDTNLARFQFS PLPVDEVSSPMKKLAFRGSVLTDESFNELLKLLRYILELSEVEFDDCTLNGLGDFNPSES DVVSELGKVETVTIRRLHIPQFYLFYDLSTVYSLLEKVKRITVENSKVFLVPCSFSQHLK SLEFLDLSENLMVEEYLKNSACKGAWPSLQTLVLSQNHLRSMQKTGEILLTLKNLTSLDI SRNTFHPMPDSCQWPEKMRFLNLSSTGIRVVKTCIPQTLEVLDVSNNNLDSFSLFLPRLQ ELYISRNKLKTLPDASLFPVLLVMKIASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCP RIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPTLVPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
| LTC | (2S)-1-({3-O-[2-(acetylamino)-4-amino-2,4,6-trideoxy-beta-D-galactopyranosyl]-a… | C39 H70 N2 O13 | 1 |
Recognition of lipopeptide patterns by Toll-like receptor 2-Toll-like receptor 6 heterodimer. Kang, J.Y., Nan, X., Jin, M.S. et al. Immunity (2009) 31:873-884. DOI 10.1016/j.immuni.2009.09.018 · PubMed
Other PDB entries of the same protein (UniProt Q4G1L2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3A7B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.