Crystal Structure of Ferric Cytochrome P450cam Reconstituted with 6-Methyl-6-depropionated Hemin. Determined by X-ray diffraction at 1.55 Å resolution. Released 1 Jan 2008.
Explore 2ZAW in 3D Show helices and sheets RCSB PDB PDBe
2ZAW contains 29 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-15 | 4 | |
| α-helix | 20-22 | 3 | |
| β-strand | 23 | 1 | 1 |
| α-helix | 34-36 | 3 | |
| α-helix | 38-42 | 5 | |
| α-helix | 43-46 | 4 | |
| β-strand | 53-56 | 4 | 1 |
| α-helix | 58-60 | 3 | |
| β-strand | 62-65 | 4 | 1 |
| α-helix | 68-76 | 9 | |
| β-strand | 81-82 | 2 | 1 |
| α-helix | 90-95 | 6 | |
| α-helix | 109-119 | 11 | |
| α-helix | 121-142 | 22 | |
| α-helix | 143-145 | 3 | |
| β-strand | 147-149 | 3 | 2 |
| α-helix | 150 | 1 | |
| α-helix | 151-155 | 5 | |
| α-helix | 157-167 | 11 | |
| α-helix | 171-173 | 3 | |
| α-helix | 174-185 | 12 | |
| α-helix | 193-213 | 21 | |
| α-helix | 219-224 | 6 | |
| β-strand | 227-228 | 2 | 3 |
| β-strand | 231-232 | 2 | 3 |
| α-helix | 233-234 | 2 | |
| α-helix | 235-251 | 17 | |
| α-helix | 253-266 | 14 | |
| α-helix | 268-276 | 9 | |
| α-helix | 278-280 | 3 | |
| α-helix | 281-291 | 11 | |
| β-strand | 295 | 1 | 4 |
| β-strand | 297-301 | 5 | 1 |
| β-strand | 305-307 | 3 | 5 |
| β-strand | 310-312 | 3 | 5 |
| β-strand | 317-320 | 4 | 1 |
| α-helix | 322-325 | 4 | |
| α-helix | 353-355 | 3 | |
| α-helix | 360-377 | 18 | |
| β-strand | 382-383 | 2 | 2 |
| α-helix | 384 | 1 | |
| β-strand | 391-392 | 2 | 6 |
| β-strand | 396 | 1 | 4 |
| β-strand | 398-399 | 2 | 6 |
| β-strand | 403-405 | 3 | 2 |
| α-helix | 408-410 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytochrome P450-cam | A | protein | 415 | Pseudomonas putida | P00183 (AlphaFold model) |
>2ZAW_1 Cytochrome P450-cam (chains A) MTTETIQSNANLAPLPPHVPEHLVFDFDMYNPSNLSAGVQEAWAVLQESNVPDLVWTRCN GGHWIATRGQLIREAYEDYRHFSSECPFIPREAGEAYDFIPTSMDPPEQRQFRALANQVV GMPVVDKLENRIQELACSLIESLRPQGQCNFTEDYAEPFPIRIFMLLAGLPEEDIPHLKY LTDQMTRPDGSMTFAEAKEALYDYLIPIIEQRRQKPGTDAISIVANGQVNGRPITSDEAK RMCGLLLVGGLDTVVNFLSFSMEFLAKSPEHRQELIERPERIPAACEELLRRFSLVADGR ILTSDYEFHGVQLKKGDQILLPQMLSGLDERENACPMHVDFSRQKVSHTTFGHGSHLCLG QHLARREIIVTLKEWLTRIPDFSIAPGAQIQHKSGIVSGVQALPLVWDPATTKAV
Water and common crystallization additives (K, CL) are not listed.
Evaluation of the functional role of the heme-6-propionate side chain in cytochrome P450cam. Harada, K., Sakurai, K., Ikemura, K. et al. J Am Chem Soc (2008) 130:432-433. DOI 10.1021/ja077902l · PubMed
Other PDB entries of the same protein (UniProt P00183 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2ZAW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.