2ZCL: Human prostate specific antigen

Crystal structure of human prostate specific antigen complexed with an activating antibody. Determined by X-ray diffraction at 3.25 Å resolution. Released 29 Jan 2008.

Method: X-ray diffraction
Resolution: 3.25 Å
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 5,259
Mol. weight: 74.83 kDa
Ligands: NAG
Released: 29 Jan 2008

Explore 2ZCL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZCL contains 22 α-helices and 62 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	11
α-helix	7-9	3
β-strand	10-12	3	12
β-strand	18-25	8	11
α-helix	29-31	3
β-strand	34-39	6	12
β-strand	45-52	8	12
β-strand	56-59	4	12
α-helix	61-63	3
β-strand	68-72	5	11
α-helix	73-75	3
β-strand	77-82	6	11
α-helix	84-86	3
β-strand	88-94	7	12
α-helix	95-96	2
β-strand	102-103	2	12
β-strand	108-111	4	12
β-strand	117	1	13
α-helix	118-120	3
β-strand	121-124	4	14
β-strand	136-145	10	14
β-strand	146	1	13
β-strand	151-154	4	15
α-helix	155-157	3
β-strand	163-165	3	14
α-helix	166-168	3
β-strand	169-170	2	14
β-strand	175-183	9	14
β-strand	194-199	6	15
β-strand	204-209	6	15

Chain L: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	5
β-strand	10-14	5	6
β-strand	19-25	7	5
β-strand	27C-27D	2	7
β-strand	30-31	2	7
β-strand	33-38	6	6
β-strand	44-48	5	6
β-strand	54	1	6
α-helix	55	1
β-strand	62-67	6	5
β-strand	70-75	6	5
α-helix	80-82	3
β-strand	84-90	7	6
α-helix	96	1
β-strand	97-98	2	6
β-strand	102-107	6	6
β-strand	111	1	8
β-strand	114-118	5	9
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	9
β-strand	140	1	8
β-strand	144-150	7	10
β-strand	153-155	3	10
β-strand	159-160	2	9
β-strand	163	1	9
β-strand	173-182	10	9
α-helix	183-186	4
β-strand	191-198	8	10
β-strand	201-210	10	10

Chain P: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
β-strand	30-34	5	3
β-strand	39-48	9	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	64-67	4	3
β-strand	71	1	4
β-strand	81-90	10	3
α-helix	95A-95E	5
β-strand	104-108	5	3
α-helix	111-114	4
α-helix	129-131	3
β-strand	135-140	6	2
β-strand	154	1	4
β-strand	156-162	7	2
α-helix	165-171	7
β-strand	180-184	5	2
β-strand	189	1	1
β-strand	198-201	4	2
β-strand	208-215	8	2
β-strand	226-230	5	2
α-helix	231-234	4
α-helix	235-244	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prostate-specific antigen	P	protein	237	Homo sapiens	P07288 (AlphaFold model)
monoclonal antibody 8G8F5 Fab	L	protein	218	Mus musculus	P01665 (AlphaFold model)
monoclonal antibody 8G8F5 Fab	H	protein	230	Mus musculus	P01863 (AlphaFold model)

Sequence of entity 1 (P), FASTA

>2ZCL_1 Prostate-specific antigen (chains P)
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPE
DTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQ
EPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTG
GKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Sequence of entity 2 (L), FASTA

>2ZCL_2 monoclonal antibody 8G8F5 Fab (chains L)
DIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSYMNWYQQKPGQPPKLLIFAASNLAS
GIPARLSGSGSGTDFTLNIQPVEEEDAATYYCQQSNEDPYTFGGGTKLEIKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS
STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 3 (H), FASTA

>2ZCL_3 monoclonal antibody 8G8F5 Fab (chains H)
QVQLQQSGDDLVKPGASVKLSCKASGYTFTTYYINWMRQRPGQGLEWIGRIAPASGTTYS
SEMFKDKATLTVDTSSNTAYIQLSSLSSEDSAVYFCARADYGFNSGEAMDYWGQGTSVTV
SSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNSGSLSSGVHTFPAVLQ
SDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRDCGCKPCI

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody. Michel, S., Muller, B.H., Bossus, M. et al. J Mol Biol (2008) 376:1021-1033. DOI 10.1016/j.jmb.2007.11.052 · PubMed

Other PDB entries of the same protein (UniProt P07288 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9F1I 1.38 Å, Crystal structure of a first-in-class antibody for alpha-1,6-fucosylated…
9ZJQ 2.2 Å, Human KLK3 following acylation by CDD-3290
2ZCH 2.83 Å, Crystal structure of human prostate specific antigen complexed with an activating antibody
2ZCK 3.1 Å, Crystal structure of a ternary complex between PSA, a substrat-acyl intermediate and an…
3QUM 3.2 Å, Crystal structure of human prostate specific antigen (PSA) in Fab sandwich with a high…

Browse structure collections

About this viewer

MolViewer shows 2ZCL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.