9ZJQ: Human KLK3 following acylation by CDD-3290

Human KLK3 following acylation by CDD-3290. Determined by X-ray diffraction at 2.2 Å resolution. Released 24 Dec 2025.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,948
Mol. weight: 28.19 kDa
Ligands: A1C2U
Released: 24 Dec 2025

Explore 9ZJQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ZJQ contains 8 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	26	1	1
β-strand	29-30	2	2
β-strand	39-44	6	3
β-strand	47-56	10	3
β-strand	59-62	4	3
α-helix	64-66	3
β-strand	71-75	5	3
β-strand	79	1	4
β-strand	88-97	10	3
α-helix	103-105	3
β-strand	122-126	5	3
α-helix	129-132	4
β-strand	133	1	5
β-strand	136	1	5
α-helix	138-142	5
α-helix	145-147	3
β-strand	151-156	6	2
β-strand	170	1	4
β-strand	172-179	8	2
α-helix	181-187	7
β-strand	196-200	5	2
β-strand	207	1	1
β-strand	216-219	4	2
β-strand	222-229	8	2
β-strand	241-245	5	2
α-helix	246-249	4
α-helix	250-259	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prostate-specific antigen	A	protein	249	Homo sapiens	P07288 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9ZJQ_1 Prostate-specific antigen (chains A)
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPE
DTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQ
EPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTG
GKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPEFV
EHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
A1C2U	1H-1,3-benzimidazole-5-carbaldehyde	C8 H6 N2 O	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Human KLK3 following acylation by CDD-3290. Fraser, B.J., Dong, A., Wilson, R. et al. To be published.

Other PDB entries of the same protein (UniProt P07288 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9F1I 1.38 Å, Crystal structure of a first-in-class antibody for alpha-1,6-fucosylated…
2ZCH 2.83 Å, Crystal structure of human prostate specific antigen complexed with an activating antibody
2ZCK 3.1 Å, Crystal structure of a ternary complex between PSA, a substrat-acyl intermediate and an…
3QUM 3.2 Å, Crystal structure of human prostate specific antigen (PSA) in Fab sandwich with a high…
2ZCL 3.25 Å, Crystal structure of human prostate specific antigen complexed with an activating antibody

Browse structure collections

About this viewer

MolViewer shows 9ZJQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.