2ZFY: Human Otubain 1

Crystal structure of human Otubain 1. Determined by X-ray diffraction at 1.69 Å resolution. Released 19 Feb 2008.

Method: X-ray diffraction
Resolution: 1.69 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,965
Mol. weight: 27.13 kDa
Released: 19 Feb 2008

Explore 2ZFY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZFY contains 12 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	48	1	1
β-strand	52-53	2	2
α-helix	54-60	7
α-helix	66-75	10
β-strand	81-83	3	2
β-strand	85	1	1
α-helix	91-104	14
α-helix	108-127	20
α-helix	132-150	19
α-helix	155-162	8
α-helix	165-185	21
α-helix	187-190	4
α-helix	191-193	3
α-helix	200-203	4
α-helix	204-208	5
α-helix	217-227	11
β-strand	231-235	5	2
β-strand	245-249	5	2
β-strand	257-262	6	2
β-strand	265-270	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin thioesterase OTUB1	A	protein	234	Homo sapiens	Q96FW1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ZFY_1 Ubiquitin thioesterase OTUB1 (chains A)
GSEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFG
FSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVAD
LLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDH
IHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK

Primary citation

Structural basis and specificity of human otubain 1-mediated deubiquitination. Edelmann, M.J., Iphofer, A., Akutsu, M. et al. Biochem J (2009) 418:379-390. DOI 10.1042/BJ20081318 · PubMed

Other PDB entries of the same protein (UniProt Q96FW1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LDT 1.9 Å, The structure of h/ceOTUB1-ubiquitin aldehyde-UBCH5B~Ub
4I6L 2.49 Å, Crystal structure of OTUB1 in complex with ubiquitin variant
4DHZ 3.11 Å, The structure of h/ceOTUB1-ubiquitin aldehyde-UBC13~Ub
3VON 3.15 Å, Crystalstructure of the ubiquitin protease
4DDG 3.3 Å, Crystal structure of human OTUB1/UbcH5b~Ub/Ub
4DDI 3.8 Å, Crystal structure of human OTUB1/UbcH5b~Ub/Ub

Browse structure collections

About this viewer

MolViewer shows 2ZFY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.