4I6L: OTUB1

Crystal structure of OTUB1 in complex with ubiquitin variant. Determined by X-ray diffraction at 2.49 Å resolution. Released 16 Jan 2013.

Method: X-ray diffraction
Resolution: 2.49 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,479
Mol. weight: 35.33 kDa
Released: 16 Jan 2013

Explore 4I6L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4I6L contains 17 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	48-53	6	1
α-helix	54-60	7
α-helix	66-76	11
β-strand	81-85	5	1
α-helix	91-103	13
α-helix	104-106	3
α-helix	108-127	20
α-helix	132-150	19
α-helix	155-161	7
α-helix	165-185	21
α-helix	187-190	4
α-helix	191-193	3
α-helix	200-203	4
α-helix	204-208	5
α-helix	217-226	10
β-strand	231-235	5	1
β-strand	247-249	3	1
β-strand	257-262	6	1
β-strand	265-270	6	1

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-7	7	2
β-strand	12-17	6	2
β-strand	22	1	3
α-helix	23-34	12
α-helix	38-40	3
β-strand	41-45	5	2
β-strand	48-49	2	2
α-helix	50-51	2
β-strand	55	1	3
α-helix	56-59	4
β-strand	66-71	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin thioesterase OTUB1	A	protein	229	Homo sapiens	Q96FW1 (AlphaFold model)
Ubiquitin	B	protein	76	Homo sapiens	P0CG48 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4I6L_1 Ubiquitin thioesterase OTUB1 (chains A)
GSNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNSFYRAFGFSHLE
ALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASF
NDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIA
LAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK

Sequence of entity 2 (B), FASTA

>4I6L_2 Ubiquitin (chains B)
GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQKLLFARKQLEDGRTLSD
YNIHKESFLYLVLRLR

Primary citation

A strategy for modulation of enzymes in the ubiquitin system. Ernst, A., Avvakumov, G., Tong, J. et al. Science (2013) 339:590-595. DOI 10.1126/science.1230161 · PubMed

Other PDB entries of the same protein (UniProt Q96FW1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZFY 1.69 Å, Crystal structure of human Otubain 1
4LDT 1.9 Å, The structure of h/ceOTUB1-ubiquitin aldehyde-UBCH5B~Ub
4DHZ 3.11 Å, The structure of h/ceOTUB1-ubiquitin aldehyde-UBC13~Ub
3VON 3.15 Å, Crystalstructure of the ubiquitin protease
4DDG 3.3 Å, Crystal structure of human OTUB1/UbcH5b~Ub/Ub
4DDI 3.8 Å, Crystal structure of human OTUB1/UbcH5b~Ub/Ub

Browse structure collections

About this viewer

MolViewer shows 4I6L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.