2ZHX: Uracil-DNA glycosylase
Crystal structure of Uracil-DNA Glycosylase from Mycobacterium tuberculosis in complex with a proteinaceous inhibitor. Determined by X-ray diffraction at 3.1 Å resolution. Released 20 May 2008.
- Method
- X-ray diffraction
- Resolution
- 3.1 Å
- Organisms
- Mycobacterium tuberculosis H37Rv, Bacillus phage PBS2
- Chains
- 14
- Atoms
- 16,840
- Mol. weight
- 247.07 kDa
- Released
- 20 May 2008
Explore 2ZHX in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2ZHX contains 121 α-helices and 80 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 15 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-8 | 3 | |
| α-helix | 14-18 | 5 | |
| α-helix | 19-21 | 3 | |
| α-helix | 22-37 | 16 | |
| α-helix | 46-48 | 3 | |
| α-helix | 51-54 | 4 | |
| β-strand | 62-65 | 4 | 1 |
| α-helix | 69-70 | 2 | |
| α-helix | 92-104 | 13 | |
| α-helix | 107-110 | 4 | |
| α-helix | 116-119 | 4 | |
| β-strand | 123-124 | 2 | 1 |
| α-helix | 145-158 | 14 | |
| β-strand | 163-168 | 6 | 1 |
| α-helix | 170-173 | 4 | |
| β-strand | 184-189 | 6 | 1 |
| α-helix | 197-199 | 3 | |
| α-helix | 206-216 | 11 | |
| α-helix | 220-222 | 3 | |
Chain B: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-12 | 8 | |
| β-strand | 18-24 | 7 | 2 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 2 |
| β-strand | 53-60 | 8 | 2 |
| β-strand | 67-73 | 7 | 2 |
| β-strand | 79-83 | 5 | 2 |
Chain C: 15 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 14-18 | 5 | |
| α-helix | 19-21 | 3 | |
| α-helix | 22-37 | 16 | |
| α-helix | 46-48 | 3 | |
| α-helix | 51-54 | 4 | |
| β-strand | 62-64 | 3 | 3 |
| β-strand | 66 | 1 | 4 |
| α-helix | 92-104 | 13 | |
| α-helix | 107-110 | 4 | |
| α-helix | 116-119 | 4 | |
| β-strand | 123-124 | 2 | 3 |
| β-strand | 127 | 1 | 4 |
| β-strand | 133 | 1 | 5 |
| β-strand | 136 | 1 | 5 |
| α-helix | 145-158 | 14 | |
| β-strand | 163-168 | 6 | 3 |
| α-helix | 170-173 | 4 | |
| β-strand | 184-189 | 6 | 3 |
| α-helix | 194-196 | 3 | |
| α-helix | 197-201 | 5 | |
| α-helix | 206-216 | 11 | |
| α-helix | 220-222 | 3 | |
Chain D: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-12 | 7 | |
| β-strand | 18-24 | 7 | 6 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 6 |
| β-strand | 53-59 | 7 | 6 |
| β-strand | 67-73 | 7 | 6 |
| β-strand | 79-83 | 5 | 6 |
Chain E: 15 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 14-18 | 5 | |
| α-helix | 19-21 | 3 | |
| α-helix | 22-37 | 16 | |
| α-helix | 46-48 | 3 | |
| α-helix | 51-54 | 4 | |
| β-strand | 62-65 | 4 | 7 |
| β-strand | 66 | 1 | 8 |
| α-helix | 92-104 | 13 | |
| α-helix | 107-110 | 4 | |
| α-helix | 116-119 | 4 | |
| β-strand | 123-124 | 2 | 7 |
| β-strand | 127 | 1 | 8 |
| α-helix | 145-158 | 14 | |
| β-strand | 163-168 | 6 | 7 |
| α-helix | 170-173 | 4 | |
| β-strand | 184-189 | 6 | 7 |
| α-helix | 194-196 | 3 | |
| α-helix | 197-201 | 5 | |
| α-helix | 206-216 | 11 | |
| α-helix | 220-222 | 3 | |
Chain F: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-12 | 7 | |
| β-strand | 20-24 | 5 | 9 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 9 |
| β-strand | 53-60 | 8 | 9 |
| β-strand | 67-73 | 7 | 9 |
| β-strand | 79-83 | 5 | 9 |
Chain G: 15 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| α-helix | 14-18 | 5 | |
| α-helix | 19-21 | 3 | |
| α-helix | 22-38 | 17 | |
| α-helix | 46-48 | 3 | |
| α-helix | 51-54 | 4 | |
| β-strand | 62-65 | 4 | 10 |
| α-helix | 92-104 | 13 | |
| α-helix | 107-110 | 4 | |
| α-helix | 116-119 | 4 | |
| β-strand | 123-124 | 2 | 10 |
| α-helix | 145-158 | 14 | |
| β-strand | 163-168 | 6 | 10 |
| α-helix | 170-173 | 4 | |
| β-strand | 184-189 | 6 | 10 |
| α-helix | 194-196 | 3 | |
| α-helix | 197-201 | 5 | |
| α-helix | 206-216 | 11 | |
| α-helix | 220-222 | 3 | |
Chain H: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-11 | 7 | |
| β-strand | 20-24 | 5 | 11 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 11 |
| β-strand | 53-59 | 7 | 11 |
| β-strand | 67-73 | 7 | 11 |
| β-strand | 79-83 | 5 | 11 |
6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Uracil-DNA glycosylase | A, C, E, G, I, K, M | protein | 238 | Mycobacterium tuberculosis H37Rv | P9WFQ9 (AlphaFold model) |
| Uracil-DNA glycosylase inhibitor | B, D, F, H, J, L, N | protein | 84 | Bacillus phage PBS2 | P14739 (AlphaFold model) |
Sequence of entity 1 (A, C, E, G, I, K, M), FASTA
>2ZHX_1 Uracil-DNA glycosylase (chains A, C, E, G, I, K, M)
MHHHHHHGMASMTARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNV
LRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPL
PSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWG
RDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP
Sequence of entity 2 (B, D, F, H, J, L, N), FASTA
>2ZHX_2 Uracil-DNA glycosylase inhibitor (chains B, D, F, H, J, L, N)
MTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTS
DAPEYKPWALVIQDSNGENKIKML
Primary citation
Unique features of the structure and interactions of mycobacterial uracil-DNA glycosylase: structure of a complex of the Mycobacterium tuberculosis enzyme in comparison with those from other sources. Kaushal, P.S., Talawar, R.K., Krishna, P.D.V. et al. Acta Crystallogr D Biol Crystallogr (2008) 64:551-560. DOI 10.1107/S090744490800512X · PubMed
Other PDB entries of the same protein (UniProt P9WFQ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4WPK 0.98 Å, Crystal structure of Mycobacterium tuberculosis uracil-DNA glycosylase, Form I
- 4WS6 1.1 Å, Crystal structure of Mycobacterium tuberculosis uracil-DNA glycosylase in complex with…
- 4WS2 1.13 Å, Crystal structure of Mycobacterium tuberculosis uracil-DNA glycosylase in complex with…
- 4WPL 1.15 Å, Crystal structure of Mycobacterium tuberculosis uracil-DNA glycosylase in complex with…
- 4WS4 1.18 Å, Crystal structure of Mycobacterium tuberculosis uracil-DNA glycosylase in complex with…
- 4WRZ 1.19 Å, Crystal structure of Mycobacterium tuberculosis uracil-DNA glycosylase in complex with…
- 4WRU 1.24 Å, Crystal structure of Mycobacterium tuberculosis uracil-DNA glycosylase in complex with…
- 8I61 1.24 Å, Crystal structure of Mycobacterium tuberculosis Uracil-DNA glycosylase in complex with…
- 8I62 1.26 Å, Crystal structure of Mycobacterium tuberculosis Uracil-DNA glycosylase in complex with…
- 4WRX 1.4 Å, Crystal structure of Mycobacterium tuberculosis uracil-DNA glycosylase, Form V
- 4WS1 1.4 Å, Crystal structure of Mycobacterium tuberculosis uracil-DNA glycosylase in complex with…
- 4WS3 1.4 Å, Crystal structure of Mycobacterium tuberculosis uracil-DNA glycosylase in complex with…
Browse structure collections
About this viewer
MolViewer shows 2ZHX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.