2ZKC: Estrogen-related receptor gamma

Crystal structure of human estrogen-related receptor gamma ligand binding domain complex with bisphenol Z. Determined by X-ray diffraction at 1.7 Å resolution. Released 17 Mar 2009.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,153
Mol. weight: 28.06 kDa
Ligands: BPZ
Released: 17 Mar 2009

Explore 2ZKC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZKC contains 13 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	236-243	8
α-helix	245-248	4
α-helix	258-259	2
α-helix	261-283	23
α-helix	289-291	3
α-helix	294-316	23
β-strand	324-327	4	1
β-strand	330-332	3	1
α-helix	334-340	7
α-helix	343-358	16
α-helix	363-375	13
α-helix	385-406	22
α-helix	413-418	6
α-helix	421-441	21
α-helix	448-455	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Estrogen-related receptor gamma	A	protein	244	Homo sapiens	P62508 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ZKC_1 Estrogen-related receptor gamma (chains A)
LGSPEFLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRE
LVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDED
QSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVL
HEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLE
AKVC

Ligands and cofactors

ID	Name	Formula	Copies
BPZ	4,4'-cyclohexane-1,1-diyldiphenol	C18 H20 O2	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystal structure of human estrogen-related receptor gamma ligand binding domain complex with bisphenol Z. Matsushima, A., Kakuta, Y., Teramoto, T. et al. To be published.

Other PDB entries of the same protein (UniProt P62508 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XXC 1.3 Å, Ternary complex of 14-3-3 sigma (C38N), Estrogen Related Receptor gamma (DBD)…
6XY5 1.3 Å, Ternary complex of 14-3-3 sigma (C38N), Estrogen Related Receptor gamma (DBD)…
6Y18 1.3 Å, Ternary complex of 14-3-3 sigma (C38N), Estrogen Related Receptor gamma (DBD)…
6Y3W 1.34 Å, Ternary complex of 14-3-3 sigma (C38N), Estrogen Related Receptor gamma (DBD)…
6Y1D 1.38 Å, Binary complex of 14-3-3 sigma (C38N) with the Estrogen Related Receptor gamma (DBD)…
8B4Q 1.4 Å, Ternary structure of 14-3-3s, ERRg phosphopeptide and dual-reactive compound 5
8BJG 1.4 Å, Ternary structure of 14-3-3s, ERRg phosphopeptide and dual-reactive compound 8
8BJN 1.4 Å, Ternary structure of 14-3-3s, ERRg phosphopeptide and dual-reactive compound 6
8BM5 1.4 Å, Ternary structure of 14-3-3s, ERRg phosphopeptide and dual-reactive compound 7
6I65 1.5 Å, Crystal structure of human ERRg LBD in complex with 4-iso-propylphenol
9KNG 1.5 Å, Crystal structure of human ERRg LBD in complex with 4034496
9KND 1.52 Å, Crystal structure of human ERRg LBD in complex with indole

Browse structure collections

About this viewer

MolViewer shows 2ZKC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.