2ZNR: DUB domain of human AMSH-LP

Crystal structure of the DUB domain of human AMSH-LP. Determined by X-ray diffraction at 1.2 Å resolution. Released 2 Sept 2008.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,732
Mol. weight: 20.68 kDa
Ligands: ZN, PR
Released: 2 Sept 2008

Explore 2ZNR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZNR contains 7 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	266-268	3
β-strand	269-272	4	1
α-helix	275-287	13
β-strand	294-302	9	1
β-strand	305-313	9	1
β-strand	316-319	4	2
β-strand	322-325	4	2
α-helix	328-338	11
β-strand	341-348	8	1
α-helix	353	1
α-helix	358-370	13
β-strand	375-380	6	1
α-helix	381-383	3
β-strand	385-391	7	1
α-helix	393-401	9
β-strand	417-419	3	1
β-strand	423-426	4	1
β-strand	431-434	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AMSH-like protease	A	protein	178	Homo sapiens	Q96FJ0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ZNR_1 AMSH-like protease (chains A)
GPGHMEGLRCVVLPEDLCHKFLQLAESNTVRGIETCGILCGKLTHNEFTITHVIVPKQSA
GPDYCDMENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIV
CSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSICKHVLVKDIKIIVLDLR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
PR	Praseodymium ion	Pr	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Structural basis for specific cleavage of Lys 63-linked polyubiquitin chains. Sato, Y., Yoshikawa, A., Yamagata, A. et al. Nature (2008) 455:358-362. DOI 10.1038/nature07254 · PubMed

Other PDB entries of the same protein (UniProt Q96FJ0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZNV 1.6 Å, Crystal structure of human AMSH-LP DUB domain in complex with Lys63-linked ubiquitin dimer
7L97 2.01 Å, Crystal structure of STAMBPL1 in complex with an engineered binder

Browse structure collections

About this viewer

MolViewer shows 2ZNR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.