7L97: STAMBPL1

Crystal structure of STAMBPL1 in complex with an engineered binder. Determined by X-ray diffraction at 2.01 Å resolution. Released 25 Aug 2021.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,040
Mol. weight: 28.88 kDa
Ligands: ZN
Released: 25 Aug 2021

Explore 7L97 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7L97 contains 9 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	266-268	3
β-strand	269-272	4	1
α-helix	275-288	14
β-strand	294-302	9	1
β-strand	305-313	9	1
β-strand	317-318	2	2
β-strand	323-324	2	2
α-helix	329-337	9
β-strand	341-348	8	1
α-helix	358-370	13
β-strand	375-380	6	1
β-strand	385-391	7	1
α-helix	393-401	9
β-strand	417-419	3	1
β-strand	423-426	4	1
β-strand	431-434	4	1

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	3
β-strand	12-17	6	3
β-strand	22	1	4
α-helix	23-34	12
α-helix	38-40	3
β-strand	41-45	5	3
β-strand	48-49	2	3
α-helix	50-51	2
β-strand	55	1	4
α-helix	57-59	3
β-strand	66-71	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AMSH-like protease	A	protein	175	Homo sapiens	Q96FJ0 (AlphaFold model)
Ubiquitin variant	B	protein	79	Homo sapiens

Sequence of entity 1 (A), FASTA

>7L97_1 AMSH-like protease (chains A)
GVEGLRCVVLPEDLCHKFLQLAESNTVRGIETCGILCGKLTHNEFTITHVIVPKQSAGPD
YCDMENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSP
KHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSICKHVLVKDIKIIVLDLR

Sequence of entity 2 (B), FASTA

>7L97_2 Ubiquitin variant (chains B)
GMDIFVSTLTGKGITLEVEPSDTIENVKAKIQDKEGIPPDQQGLIFARKQLEDGRTLSDY
NIQQGSTLYLVLRHRHSAS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (EDO, SO4, UNX) are not listed.

Primary citation

Structural and functional characterization of ubiquitin variant inhibitors for the JAMM-family deubiquitinases STAMBP and STAMBPL1. Guo, Y., Liu, Q., Mallette, E. et al. J Biol Chem (2021) 297:101107-101107. DOI 10.1016/j.jbc.2021.101107 · PubMed

Other PDB entries of the same protein (UniProt Q96FJ0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZNR 1.2 Å, Crystal structure of the DUB domain of human AMSH-LP
2ZNV 1.6 Å, Crystal structure of human AMSH-LP DUB domain in complex with Lys63-linked ubiquitin dimer

Browse structure collections

About this viewer

MolViewer shows 7L97 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.