2ZTX: Complex structure of CVB3 3C protease with EPDTC

Complex structure of CVB3 3C protease with EPDTC. Determined by X-ray diffraction at 1.72 Å resolution. Released 13 Jan 2009.

Method: X-ray diffraction
Resolution: 1.72 Å
Organism: Human coxsackievirus B3
Chains: 1
Atoms: 1,609
Mol. weight: 20.43 kDa
Ligands: DTZ
Released: 13 Jan 2009

Explore 2ZTX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZTX contains 8 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-14	13
β-strand	15-20	6	1
β-strand	23-31	9	1
β-strand	32	1	2
β-strand	34-38	5	1
α-helix	39-41	3
β-strand	46-49	4	1
β-strand	52-63	12	1
β-strand	69-77	9	1
α-helix	81-82	2
β-strand	83	1	2
α-helix	84	1
α-helix	87-89	3
β-strand	90	1	1
α-helix	94-96	3
β-strand	97-104	8	1
β-strand	112-127	16	1
β-strand	130-138	9	1
α-helix	149	1
β-strand	150-153	4	1
β-strand	156-164	9	1
β-strand	169-173	5	1
α-helix	176-179	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
3C proteinase	A	protein	183	Human coxsackievirus B3	P03313

Sequence of entity 1 (A), FASTA

>2ZTX_1 3C proteinase (chains A)
GPAFEFAVAMMKRNSSTVKTEYGEFTMLGIYDRWAVLPRHAKPGPTILMNDQEVGVLDAK
ELVDKDGTNLELTLLKLNRNEKFRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVT
EYGFLNLGGTPTKRMLMYNFPTRAGQCGGVLMSTGKVLGIHVGGNGHQGFSAALLKHYFN
DEQ

Ligands and cofactors

ID	Name	Formula	Copies
DTZ	zinc(II)hydrogensulfide	H2 S2 Zn	1

Primary citation

Structural Basis of Inhibition Specificities of 3C and 3C-like Proteases by Zinc-coordinating and Peptidomimetic Compounds. Lee, C.C., Kuo, C.J., Ko, T.P. et al. J Biol Chem (2009) 284:7646-7655. DOI 10.1074/jbc.M807947200 · PubMed

Other PDB entries of the same protein (UniProt P03313), best resolution first:

7W0Q 1.1 Å, TRIM7 in complex with C-terminal peptide of 2C
2ZU1 1.38 Å, crystal structure of CVB3 3C protease mutant C147A
7W0S 1.4 Å, TRIM7 in complex with C-terminal peptide of 2C
6S3A 1.52 Å, Coxsackie B3 2C protein in complex with S-Fluoxetine
7W0T 1.57 Å, TRIM7 in complex with C-terminal peptide of 2C
7QUW 1.65 Å, CVB3-3Cpro in complex with inhibitor MG-78
2ZTY 1.72 Å, crystal structure of 3C protease from CVB3 in space group C2
2ZU3 1.75 Å, Complex structure of CVB3 3C protease with TG-0204998
4WFZ 1.8 Å, Coxsackievirus B3 3Dpol RNA Dependent RNA Polymerase - NaCl Crystal Form
4WFX 1.81 Å, Coxsackievirus B3 Polymerase - F232L Mutant - NaCl Crystal Form
6T3W 1.82 Å, Coxsackie B3 2C protein in complex with S-Fluoxetine
8S6F 1.93 Å, A Structural Investigation of the Interaction between a GC-376-Based Peptidomimetic…

Browse structure collections

About this viewer

MolViewer shows 2ZTX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.