Complex structure of CVB3 3C protease with EPDTC. Determined by X-ray diffraction at 1.72 Å resolution. Released 13 Jan 2009.
Explore 2ZTX in 3D Show helices and sheets RCSB PDB PDBe
2ZTX contains 8 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-14 | 13 | |
| β-strand | 15-20 | 6 | 1 |
| β-strand | 23-31 | 9 | 1 |
| β-strand | 32 | 1 | 2 |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 39-41 | 3 | |
| β-strand | 46-49 | 4 | 1 |
| β-strand | 52-63 | 12 | 1 |
| β-strand | 69-77 | 9 | 1 |
| α-helix | 81-82 | 2 | |
| β-strand | 83 | 1 | 2 |
| α-helix | 84 | 1 | |
| α-helix | 87-89 | 3 | |
| β-strand | 90 | 1 | 1 |
| α-helix | 94-96 | 3 | |
| β-strand | 97-104 | 8 | 1 |
| β-strand | 112-127 | 16 | 1 |
| β-strand | 130-138 | 9 | 1 |
| α-helix | 149 | 1 | |
| β-strand | 150-153 | 4 | 1 |
| β-strand | 156-164 | 9 | 1 |
| β-strand | 169-173 | 5 | 1 |
| α-helix | 176-179 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 3C proteinase | A | protein | 183 | Human coxsackievirus B3 | P03313 |
>2ZTX_1 3C proteinase (chains A) GPAFEFAVAMMKRNSSTVKTEYGEFTMLGIYDRWAVLPRHAKPGPTILMNDQEVGVLDAK ELVDKDGTNLELTLLKLNRNEKFRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVT EYGFLNLGGTPTKRMLMYNFPTRAGQCGGVLMSTGKVLGIHVGGNGHQGFSAALLKHYFN DEQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| DTZ | zinc(II)hydrogensulfide | H2 S2 Zn | 1 |
Structural Basis of Inhibition Specificities of 3C and 3C-like Proteases by Zinc-coordinating and Peptidomimetic Compounds. Lee, C.C., Kuo, C.J., Ko, T.P. et al. J Biol Chem (2009) 284:7646-7655. DOI 10.1074/jbc.M807947200 · PubMed
Other PDB entries of the same protein (UniProt P03313), best resolution first:
MolViewer shows 2ZTX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.