2ZU3: 3C proteinase

Complex structure of CVB3 3C protease with TG-0204998. Determined by X-ray diffraction at 1.75 Å resolution. Released 13 Jan 2009.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Human coxsackievirus
Chains: 1
Atoms: 1,641
Mol. weight: 20.91 kDa
Ligands: ZU3
Released: 13 Jan 2009

Explore 2ZU3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZU3 contains 5 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-14	13
β-strand	15-20	6	1
β-strand	23-31	9	1
β-strand	32	1	2
β-strand	34-38	5	1
α-helix	39-41	3
β-strand	46-49	4	1
β-strand	52-63	12	1
β-strand	69-78	10	1
β-strand	83	1	2
α-helix	87-89	3
β-strand	90	1	1
β-strand	97-104	8	1
β-strand	112-127	16	1
β-strand	130-139	10	1
α-helix	149	1
β-strand	150-153	4	1
β-strand	156-165	10	1
β-strand	168-173	6	1
α-helix	176-179	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
3C proteinase	A	protein	183	Human coxsackievirus	P03313

Sequence of entity 1 (A), FASTA

>2ZU3_1 3C proteinase (chains A)
GPAFEFAVAMMKRNSSTVKTEYGEFTMLGIYDRWAVLPRHAKPGPTILMNDQEVGVLDAK
ELVDKDGTNLELTLLKLNRNEKFRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVT
EYGFLNLGGTPTKRMLMYNFPTRAGQCGGVLMSTGKVLGIHVGGNGHQGFSAALLKHYFN
DEQ

Ligands and cofactors

ID	Name	Formula	Copies
ZU3	N-[(benzyloxy)carbonyl]-3-[(2,2-dimethylpropanoyl)amino]-L-alanyl-N-[(1R)-4-oxo…	C32 H49 N5 O7	1

Primary citation

Structural Basis of Inhibition Specificities of 3C and 3C-like Proteases by Zinc-coordinating and Peptidomimetic Compounds. Lee, C.C., Kuo, C.J., Ko, T.P. et al. J Biol Chem (2009) 284:7646-7655. DOI 10.1074/jbc.M807947200 · PubMed

Other PDB entries of the same protein (UniProt P03313), best resolution first:

7W0Q 1.1 Å, TRIM7 in complex with C-terminal peptide of 2C
2ZU1 1.38 Å, crystal structure of CVB3 3C protease mutant C147A
7W0S 1.4 Å, TRIM7 in complex with C-terminal peptide of 2C
6S3A 1.52 Å, Coxsackie B3 2C protein in complex with S-Fluoxetine
7W0T 1.57 Å, TRIM7 in complex with C-terminal peptide of 2C
7QUW 1.65 Å, CVB3-3Cpro in complex with inhibitor MG-78
2ZTX 1.72 Å, Complex structure of CVB3 3C protease with EPDTC
2ZTY 1.72 Å, crystal structure of 3C protease from CVB3 in space group C2
4WFZ 1.8 Å, Coxsackievirus B3 3Dpol RNA Dependent RNA Polymerase - NaCl Crystal Form
4WFX 1.81 Å, Coxsackievirus B3 Polymerase - F232L Mutant - NaCl Crystal Form
6T3W 1.82 Å, Coxsackie B3 2C protein in complex with S-Fluoxetine
8S6F 1.93 Å, A Structural Investigation of the Interaction between a GC-376-Based Peptidomimetic…

Browse structure collections

About this viewer

MolViewer shows 2ZU3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.