2ZVV: Proliferating cellular nuclear antigen 1

Crystal structure of Proliferating cellular nuclear antigen 1 and Short peptide from human P21. Determined by X-ray diffraction at 2.0 Å resolution. Released 2 Jun 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Arabidopsis thaliana
Chains: 4
Atoms: 4,382
Mol. weight: 66.77 kDa
Released: 2 Jun 2009

Explore 2ZVV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZVV contains 21 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	10-19	10
β-strand	25-31	7	2
β-strand	34-40	7	2
β-strand	46-53	8	2
α-helix	54-56	3
β-strand	59-62	4	1
β-strand	66-71	6	2
α-helix	72-80	9
β-strand	87-92	6	1
β-strand	98-104	7	1
β-strand	111-117	7	1
β-strand	121-122	2	3
α-helix	123-125	3
β-strand	135-140	6	2
α-helix	141-152	12
β-strand	157-163	7	4
β-strand	166-173	8	4
β-strand	176-182	7	4
α-helix	191-193	3
β-strand	196-199	4	2
β-strand	203-208	6	4
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	2
β-strand	235-241	7	2
β-strand	245-251	7	2
α-helix	252-253	2
β-strand	254	1	4

Chain B: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	5
α-helix	9-19	11
β-strand	25-30	6	6
β-strand	34-40	7	6
β-strand	46-53	8	6
α-helix	54-56	3
β-strand	59-62	4	5
β-strand	66-71	6	6
α-helix	72-79	8
β-strand	87-92	6	5
β-strand	98-104	7	5
β-strand	111-117	7	5
β-strand	120-121	2	3
α-helix	125	1
β-strand	126	1	7
α-helix	127	1
β-strand	135-140	6	6
α-helix	141-152	12
β-strand	157-163	7	8
β-strand	166-173	8	8
β-strand	176-182	7	8
α-helix	191-193	3
β-strand	196-199	4	6
β-strand	203-208	6	8
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	6
β-strand	235-241	7	6
β-strand	245-251	7	6
α-helix	252-253	2
β-strand	254-255	2	8

Chain X: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	144	1	4
α-helix	147-149	3

Chain Y: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	143-144	2	8
α-helix	147-149	3
β-strand	153	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proliferating cellular nuclear antigen 1	A, B	protein	276	Arabidopsis thaliana	Q9M7Q7 (AlphaFold model)
Cyclin-dependent kinase inhibitor 1	X, Y	protein	22		P38936 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2ZVV_1 Proliferating cellular nuclear antigen 1 (chains A, B)
MGSSHHHHHHSSGLVPRGSHMLELRLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAM
DSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVT
FMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSNEFSRICKDLSSIGDTVVI
SVTKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAIVIEMKEPVSLSFALRYMNSFTKATP
LSDTVTISLSSELPVVVEYKVAEMGYIRYYLAPKIE

Sequence of entity 2 (X, Y), FASTA

>2ZVV_2 Cyclin-dependent kinase inhibitor 1 (chains X, Y)
GRKRRQTSMTDFYHSKRRLIFS

Primary citation

Crystal structures of the Arabidopsis thaliana proliferating cell nuclear antigen 1 and 2 proteins complexed with the human p21 C-terminal segment. Strzalka, W., Oyama, T., Tori, K. et al. Protein Sci (2009) 18:1072-1080. DOI 10.1002/pro.117 · PubMed

Other PDB entries of the same protein (UniProt Q9M7Q7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6O09 2.06 Å, Structure of AtPCNA in complex with the PIP motif of ATXR6

Browse structure collections

About this viewer

MolViewer shows 2ZVV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.