6O09: AtPCNA

Structure of AtPCNA in complex with the PIP motif of ATXR6. Determined by X-ray diffraction at 2.06 Å resolution. Released 27 Mar 2019.

Method: X-ray diffraction
Resolution: 2.06 Å
Organisms: Arabidopsis thaliana, Glycine max
Chains: 12
Atoms: 12,307
Mol. weight: 221.99 kDa
Released: 27 Mar 2019

Explore 6O09 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6O09 contains 68 α-helices and 152 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	-2	1	8
α-helix	-1-0	2
β-strand	1-6	6	9
α-helix	9-19	11
β-strand	25-30	6	10
β-strand	34-40	7	10
β-strand	46-53	8	10
α-helix	54-56	3
β-strand	59-62	4	9
β-strand	67-71	5	10
α-helix	72-79	8
β-strand	87-93	7	9
β-strand	98-104	7	9
β-strand	111-117	7	9
β-strand	119	1	10
α-helix	126-127	2
β-strand	128	1	11
α-helix	129	1
α-helix	131-133	3
β-strand	135-140	6	10
α-helix	141-152	12
β-strand	157-163	7	12
β-strand	166-173	8	12
β-strand	176-182	7	12
β-strand	185	1	13
α-helix	191-193	3
β-strand	195	1	13
β-strand	196-199	4	10
β-strand	203-208	6	12
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	10
β-strand	235-240	6	10
β-strand	245-251	7	10
α-helix	252-253	2
β-strand	254-256	3	12

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	79-81	3	12
α-helix	84-86	3

Chain C: 12 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	-2	1	1
α-helix	-1-0	2
β-strand	1-6	6	2
α-helix	9-19	11
β-strand	25-30	6	3
β-strand	34-40	7	3
β-strand	46-53	8	3
α-helix	54-56	3
β-strand	59-63	5	2
β-strand	67-71	5	3
α-helix	72-79	8
β-strand	87-93	7	2
β-strand	98-104	7	2
β-strand	111-117	7	2
β-strand	119	1	3
α-helix	124-126	3
β-strand	127	1	4
β-strand	128	1	5
α-helix	129	1
α-helix	131-133	3
β-strand	135-140	6	3
α-helix	141-152	12
β-strand	157-163	7	6
β-strand	166-173	8	6
β-strand	176-182	7	6
β-strand	185	1	7
α-helix	191-193	3
β-strand	195	1	7
β-strand	196-199	4	3
β-strand	203-208	6	6
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	3
β-strand	235-240	6	3
β-strand	245-251	7	3
α-helix	252-253	2
β-strand	254-256	3	6

Chain D: 10 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	-2	1	14
α-helix	-1-0	2
β-strand	1-6	6	15
α-helix	9-19	11
β-strand	25-30	6	16
β-strand	34-40	7	16
β-strand	46-53	8	16
α-helix	54-56	3
β-strand	59-62	4	15
β-strand	66-71	6	16
α-helix	72-79	8
β-strand	87-93	7	15
β-strand	98-104	7	15
β-strand	111-117	7	15
β-strand	119	1	16
α-helix	125-126	2
β-strand	127	1	17
β-strand	128	1	1
α-helix	129	1
β-strand	135-140	6	16
α-helix	141-152	12
β-strand	157-163	7	18
β-strand	166-172	7	18
β-strand	177-182	6	18
β-strand	185	1	19
β-strand	195	1	19
β-strand	196-199	4	16
β-strand	203-208	6	18
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	16
β-strand	235-240	6	16
β-strand	245-251	7	16
α-helix	252-253	2
β-strand	254-255	2	18

Chains E and G: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	80-81	2	18
α-helix	84-86	3
β-strand	89	1	17

Chain F: 11 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	-2	1	20
α-helix	-1-0	2
β-strand	1-6	6	21
α-helix	9-19	11
β-strand	25-30	6	22
β-strand	34-40	7	22
β-strand	46-53	8	22
α-helix	54-56	3
β-strand	59-62	4	21
β-strand	67-71	5	22
α-helix	72-79	8
β-strand	87-93	7	21
β-strand	98-104	7	21
β-strand	111-117	7	21
β-strand	119	1	22
α-helix	126	1
β-strand	127	1	23
β-strand	128	1	8
α-helix	129	1
β-strand	135-140	6	22
α-helix	141-152	12
β-strand	157-163	7	24
β-strand	166-172	7	24
β-strand	177-182	6	24
β-strand	185	1	25
α-helix	191-193	3
β-strand	195	1	25
β-strand	196-199	4	22
β-strand	203-208	6	24
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	22
β-strand	235-240	6	22
β-strand	245-251	7	22
α-helix	252-253	2
β-strand	254-255	2	24

Chain H: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	-2	1	5
α-helix	-1-0	2
β-strand	1-6	6	26
α-helix	9-19	11
β-strand	25-30	6	27
β-strand	34-40	7	27
β-strand	46-53	8	27
α-helix	54-56	3
β-strand	59-61	3	26
β-strand	67-71	5	27
α-helix	72-79	8
β-strand	87-93	7	26
β-strand	98-104	7	26
β-strand	111-117	7	26
β-strand	119	1	27
α-helix	125-127	3
β-strand	128	1	14
β-strand	135-140	6	27
α-helix	141-152	12
β-strand	157-162	6	28
β-strand	167-172	6	28
β-strand	177-182	6	28
β-strand	196-199	4	27
β-strand	203-208	6	28
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	27
β-strand	235-240	6	27
β-strand	245-251	7	27
α-helix	252-253	2
β-strand	254-255	2	28

Chain I: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	79-81	3	6
α-helix	84-86	3
β-strand	89	1	4

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proliferating cellular nuclear antigen 1	A, C, D, F, H, K	protein	312	Arabidopsis thaliana	Q9M7Q7 (AlphaFold model)
Uncharacterized protein	B, E, G, I, J, L	protein	20	Glycine max	K7MRE7 (AlphaFold model)

Sequence of entity 1 (A, C, D, F, H, K), FASTA

>6O09_1 Proliferating cellular nuclear antigen 1 (chains A, C, D, F, H, K)
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMGHHHHHHENLYFQGMLELRLVQGSL
LKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMN
LGNMSKMLKCAGNDDIITIKADDGGDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDA
EYHSIVRMPSNEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVDKP
EDAIVIEMKEPVSLSFALRYMNSFTKATPLSDTVTISLSSELPVVVEYKVAEMGYIRYYL
APKIEEEEDTNP

Sequence of entity 2 (B, E, G, I, J, L), FASTA

>6O09_2 Uncharacterized protein (chains B, E, G, I, J, L)
YPLVQTKIIDFFRIQRSPEA

Primary citation

ATXR5/6 Forms Alternative Protein Complexes with PCNA and the Nucleosome Core Particle. Davarinejad, H., Joshi, M., Ait-Hamou, N. et al. J Mol Biol (2019) 431:1370-1379. DOI 10.1016/j.jmb.2019.02.020 · PubMed

Other PDB entries of the same protein (UniProt Q9M7Q7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZVV 2.0 Å, Crystal structure of Proliferating cellular nuclear antigen 1 and Short peptide from…

Browse structure collections

About this viewer

MolViewer shows 6O09 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.