The ultra-high-resolution hyaluronan-binding domain of mouse CD44. Determined by X-ray diffraction at 0.78 Å resolution. Released 12 Aug 2026.
Explore 32OA in 3D Show helices and sheets RCSB PDB PDBe
32OA contains 7 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-28 | 6 | 1 |
| β-strand | 31-32 | 2 | 1 |
| β-strand | 35-40 | 6 | 1 |
| β-strand | 46 | 1 | 2 |
| α-helix | 48-57 | 10 | |
| β-strand | 61 | 1 | 1 |
| α-helix | 62-64 | 3 | |
| α-helix | 65-73 | 9 | |
| β-strand | 82-83 | 2 | 1 |
| β-strand | 88-92 | 5 | 1 |
| β-strand | 96 | 1 | 3 |
| β-strand | 99 | 1 | 3 |
| α-helix | 100-102 | 3 | |
| β-strand | 105-108 | 4 | 1 |
| α-helix | 109 | 1 | |
| β-strand | 117 | 1 | 2 |
| β-strand | 118-122 | 5 | 1 |
| β-strand | 130-131 | 2 | 1 |
| α-helix | 134-135 | 2 | |
| β-strand | 142-151 | 10 | 1 |
| β-strand | 157-163 | 7 | 1 |
| α-helix | 168-170 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CD44 antigen | A | protein | 152 | Mus musculus | P15379 (AlphaFold model) |
>32OA_1 CD44 antigen (chains A) MNQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCR YGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPN SFDGPVTITIVNRDGTRYSKKGEYRTHQEDID
The ultra-high-resolution hyaluronan-binding domain of mouse CD44. Bradshaw, W.J., Katis, V.L., Newman, J.A. et al. To be published.
Other PDB entries of the same protein (UniProt P15379 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 32OA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.