CD44 PanDDA analysis group deposition -- The hyaluronan-binding domain of CD44 in complex with Z431807512. Determined by X-ray diffraction at 1.17 Å resolution. Released 22 Sept 2021.
Explore 5SC1 in 3D Show helices and sheets RCSB PDB PDBe
5SC1 contains 7 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 25-30 | 6 | 1 |
| β-strand | 33-34 | 2 | 1 |
| β-strand | 37-42 | 6 | 1 |
| β-strand | 48 | 1 | 2 |
| α-helix | 50-59 | 10 | |
| β-strand | 63 | 1 | 1 |
| α-helix | 64-66 | 3 | |
| α-helix | 67-75 | 9 | |
| β-strand | 84-85 | 2 | 1 |
| β-strand | 90-94 | 5 | 1 |
| β-strand | 98 | 1 | 3 |
| β-strand | 101 | 1 | 3 |
| α-helix | 102-104 | 3 | |
| β-strand | 107-110 | 4 | 1 |
| α-helix | 111 | 1 | |
| β-strand | 119 | 1 | 2 |
| β-strand | 120-124 | 5 | 1 |
| β-strand | 132-133 | 2 | 1 |
| α-helix | 136-137 | 2 | |
| β-strand | 144-154 | 11 | 1 |
| β-strand | 159-165 | 7 | 1 |
| α-helix | 170-172 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CD44 antigen | A | protein | 152 | Mus musculus | P15379 (AlphaFold model) |
>5SC1_1 CD44 antigen (chains A) MNQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCR YGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPN SFDGPVTITIVNRDGTRYSKKGEYRTHQEDID
| ID | Name | Formula | Copies |
|---|---|---|---|
| 8DH | N-methyl-3-oxo-N-(propan-2-yl)piperazine-1-sulfonamide | C8 H17 N3 O3 S | 1 |
Water and common crystallization additives (EDO, DMS) are not listed.
CD44 PanDDA analysis group deposition. Bradshaw, W.J., Katis, V.L., Bezerra, G.A. et al. To be published.
Other PDB entries of the same protein (UniProt P15379 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5SC1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.