35UG: Human DVL2 PDZ domain

Human DVL2 PDZ domain in complex with Vangl2. Determined by X-ray diffraction at 1.95 Å resolution. Released 16 Sept 2026.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,253
Mol. weight: 44.56 kDa
Released: 16 Sept 2026

Explore 35UG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

35UG contains 14 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
β-strand	19-25	7	1
β-strand	30-38	9	1
β-strand	39	1	2
α-helix	43-47	5
α-helix	54	1
β-strand	55-59	5	1
β-strand	62-63	2	1
α-helix	64-66	3
α-helix	69-80	12
β-strand	86-91	6	1
β-strand	100-104	5	3

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	4
β-strand	19-25	7	4
β-strand	30-38	9	4
β-strand	39	1	5
α-helix	43-47	5
α-helix	54	1
β-strand	55-59	5	4
β-strand	62-63	2	4
α-helix	69-80	12
β-strand	86-91	6	4
β-strand	100-104	5	6

Chain C: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	6
β-strand	19-24	6	6
β-strand	32-38	7	6
β-strand	39	1	2
α-helix	43-47	5
α-helix	54	1
β-strand	55-59	5	6
β-strand	62-63	2	6
α-helix	69-80	12
β-strand	86-91	6	6
α-helix	92-93	2
β-strand	99-103	5	4

Chain D: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	3
β-strand	19-25	7	3
β-strand	30-38	9	3
β-strand	39	1	5
α-helix	43-47	5
β-strand	53	1	7
α-helix	54	1
β-strand	55-59	5	3
β-strand	62-63	2	3
α-helix	69-81	13
β-strand	87-91	5	3
β-strand	100	1	7
β-strand	101-104	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Segment polarity protein dishevelled homolog DVL-2,Vang-like protein 2	A, B, C, D	protein	106	Homo sapiens	O14641 (AlphaFold model), Q9ULK5 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>35UG_1 Segment polarity protein dishevelled homolog DVL-2,Vang-like protein 2 (chains A, B, C, D)
GSNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVN
DMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKSGGGVSGFKVYSLG

Primary citation

Crystal structure of a Vangl2-Dvl2 complex reveals a non-canonical PDZ recognition mode in PCP signaling. Shen, G.B., Yang, H.M. To be published.

Other PDB entries of the same protein (UniProt O14641 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CBZ 1.38 Å, The Dvl2 PDZ Domain in Complex with the N2 Inhibitory Peptide
3CBY 1.5 Å, The Dvl2 PDZ Domain in Complex with the N1 Inhibitory Peptide
2REY 1.55 Å, Crystal structure of the PDZ domain of human dishevelled 2 (homologous to Drosophila dsh)
6IW3 1.64 Å, High resolution structure of Dvl2-DIX Y27W/C80S mutant
3CBX 1.7 Å, The Dvl2 PDZ Domain in Complex with the C1 Inhibitory Peptide
3CC0 1.75 Å, The Dvl2 PDZ Domain in Complex with the N3 Inhibitory Peptide
8WWR 1.75 Å, Crystal structure of apo human dishevelled 2 (Dvl2) PDZ domain
5SUZ 1.84 Å, Domain-swapped dimer of human Dishevelled2 DEP domain: C-centered monoclinic crystal…
5SUY 1.88 Å, Domain-swapped dimer of human Dishevelled2 DEP domain: monoclinic crystal form…
5LNP 1.99 Å, Domain-swapped dimer of human Dishevelled2 DEP domain: monoclinic crystal form…
4WIP 2.69 Å, DIX domain of human Dvl2
8YR7 3.0 Å, Crystal structure of human dishevelled 2 (Dvl2) PDZ domain fused with WGEF internal…

Browse structure collections

About this viewer

MolViewer shows 35UG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.