3A1G: RNA-directed RNA polymerase catalytic subunit

High-Resolution Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A Virus. Determined by X-ray diffraction at 1.7 Å resolution. Released 9 Jun 2009.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Influenza A virus (A/Puerto Rico/8/34(H1N1))
Chains: 4
Atoms: 1,889
Mol. weight: 28.81 kDa
Released: 9 Jun 2009

Explore 3A1G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3A1G contains 14 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	687-699	13
α-helix	707-709	3
β-strand	713	1	1
α-helix	714-732	19
α-helix	737-755	19

Chains B and D: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	-1-10	12
α-helix	14-22	9
β-strand	24	1	1
α-helix	27-33	7

Chain C: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	686-699	14
α-helix	707-709	3
β-strand	713	1	2
α-helix	714-732	19
α-helix	737-755	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-directed RNA polymerase catalytic subunit	A, C	protein	80	Influenza A virus (A/Puerto Rico/8/34(H1N1))	P03431 (AlphaFold model)
Polymerase basic protein 2	B, D	protein	40	Influenza A virus (A/Puerto Rico/8/34(H1N1))	P03428 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3A1G_1 RNA-directed RNA polymerase catalytic subunit (chains A, C)
SQRGVLEDEQMYQRCCNLFEKFFPSSSYRRPVGISSMVEAMVSRARIDARIDFESGRIKK
EEFTEIMKICSTIEELRRQK

Sequence of entity 2 (B, D), FASTA

>3A1G_2 Polymerase basic protein 2 (chains B, D)
GGSMERIKELRNLMSQSRTREILTKTTVDHMAIIKKYTSG

Primary citation

Structural insight into the essential PB1-PB2 subunit contact of the influenza virus RNA polymerase. Sugiyama, K., Obayashi, E., Kawaguchi, A. et al. EMBO J (2009) 28:1803-1811. DOI 10.1038/emboj.2009.138 · PubMed

Other PDB entries of the same protein (UniProt P03431 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZTT 2.1 Å, Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A Virus
2ZNL 2.3 Å, Crystal structure of PA-PB1 complex form influenza virus RNA polymerase
9IM6 3.21 Å, Structure of influenza A virus RNA polymerase PB1 and nuclear import host factor RanBP5…

Browse structure collections

About this viewer

MolViewer shows 3A1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.